PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G20350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 622aa    MW: 65226.8 Da    PI: 7.3696
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G20350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS285.91.1e-872606222374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A a+++g++e a + La l+  a+++gd  qRl+a+++ AL+ r+ +       a  p         e+ a  ++++++sP+++++ 
  OPUNC04G20350.1 260 RQLLSEAASAIADGHHETAATHLAALKRAANSRGDVEQRLVAMMVAALSCRIGQ------TASVPDLC----GGEQRAGSQILHDISPCFRLAL 343
                      689**************************************************9......22222222....4455566689************ PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +aN aI++av  ++++H +Dfd+s + Q + L++ La+R+ + +sl++T+v +p+s      + +l ++g+ L+k+Ae+ g++ +f++ v+ r
  OPUNC04G20350.1 344 HAANVAIVDAVGDHRAIHLVDFDVSAP-QHADLIRCLAARRLPGASLKVTAVTDPTSPftqsVTATLPAVGDHLQKIAERAGIEYRFKM-VSCR 435
                      ************************987.99************************9988888788899*********************9.7999 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                        ++e ++L ++ gEal+Vnl+++l +++desvs +++rde+L+ v+ l P+vv +veqe++ n++++ +rf++a+ +y a+++sl++++pres
  OPUNC04G20350.1 436 AGEIEASKLGCEAGEALVVNLAFALSHVPDESVSPANPRDEILRRVRALGPQVVALVEQELNSNTAPLTTRFTDACAHYGAILESLDVTIPRES 529
                      ********************************************************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er+  E++ l+ ++ n+v  egaer er+e ++kWr+r+++aGF+pv+l+  +a+q+ +    v+  g+ v+ e+g l lgW++r ++++SaW
  OPUNC04G20350.1 530 AERARAEAA-LAGRAANAVGREGAERLERCEVFGKWRARFGMAGFRPVALGPGIADQVLARQGPVA-AGFAVKAENGVLRLGWMGRVVTVASAW 621
                      *********.666678*****************************************977777777.99************************* PP

             GRAS 374 r 374
                      r
  OPUNC04G20350.1 622 R 622
                      8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.1233603IPR005202Transcription factor GRAS
PfamPF035143.9E-85260622IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYLYGVGS AVQMPMQQRS DAAAAAGGVL KRSLGDMERW QQHQQQQRQI  60
AMQQQLYLRT VRQRTAAASA AVSPLTSADI AAVLGGPPSQ PLVLSGSSMG GALGSPSSTL  120
SSLTTASRAV AMPLMQPQLQ RVPYMASSPQ VQAFGTARAL VPHPAVSDLS IFQELEKQLL  180
GDDDEVEAAM SGTGSAVTGS EWEEQLNSIT AAPSPPLTAA TTPNNNHNAV GMTRSPSNSS  240
TSTASSSASC SPPTSASTSR QLLSEAASAI ADGHHETAAT HLAALKRAAN SRGDVEQRLV  300
AMMVAALSCR IGQTASVPDL CGGEQRAGSQ ILHDISPCFR LALHAANVAI VDAVGDHRAI  360
HLVDFDVSAP QHADLIRCLA ARRLPGASLK VTAVTDPTSP FTQSVTATLP AVGDHLQKIA  420
ERAGIEYRFK MVSCRAGEIE ASKLGCEAGE ALVVNLAFAL SHVPDESVSP ANPRDEILRR  480
VRALGPQVVA LVEQELNSNT APLTTRFTDA CAHYGAILES LDVTIPRESA ERARAEAALA  540
GRAANAVGRE GAERLERCEV FGKWRARFGM AGFRPVALGP GIADQVLARQ GPVAAGFAVK  600
AENGVLRLGW MGRVVTVASA WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3427862222375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066880.0AL606688.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0064M23, complete sequence.
GenBankAK1002940.0AK100294.1 Oryza sativa Japonica Group cDNA clone:J023075P18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637100.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0KUA90.0A0A0E0KUA9_ORYPU; Uncharacterized protein
STRINGLOC_Os04g49110.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA014504-PA0.0(Oryza sativa Indica Group)
STRINGORGLA04G0197700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-87SCARECROW-like 8