PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G28630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GeBP
Protein Properties Length: 368aa    MW: 39390.2 Da    PI: 7.0203
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G28630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57387.12.2e-2781175297
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                      +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+ + +++sql+eK+rrLK+Kf+++++++++g +p+  ++hd+++++l++++
  OPUNC03G28630.1  81 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPSPYTRSQLSEKLRRLKNKFRGMSARVARGLDPARLAPHDRDVLHLCSRL 173
                      79*******************.556878888*************************************************************** PP

           DUF573  96 Wg 97 
                      W+
  OPUNC03G28630.1 174 WD 175
                      *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2482175IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MASDQTLPVP VSVELSPAAP NPDPTAPLPL TDDPSAPPAA ARKLPVKRRS PPPRLSSPSS  60
SDPASSDPAA KQPQPPPPPF KFQRIWSESD ELRFLQGLLG CGAQGLVFPR DLNVFYDRFS  120
ESMPSPYTRS QLSEKLRRLK NKFRGMSARV ARGLDPARLA PHDRDVLHLC SRLWDPASAA  180
TSPFAAAGDA SSGNKRRRAA PRSGPLMPPD PSGDSGSHDY NGISSGTPGA FGDGHSGEEM  240
MYLEQESGHF GFHGDVTIAA DGSLDGIVKV QPETLAALPS IGDIAVHNEN GNGKAVVPRS  300
NEHHMANAVL DIFEECLREV KANGITYGAN VNGGSELAKR WRAQRIDELD VLSRRLRLLV  360
EDAAAVGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0871810.0AC087181.9 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone OSJNBa0018H01 map R1538, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCT8338990.0CT833899.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN056B15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628567.10.0probable transcription factor At5g28040
TrEMBLA0A0E0KI250.0A0A0E0KI25_ORYPU; Uncharacterized protein
STRINGOPUNC03G28630.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.24e-11DNA-binding storekeeper protein-related transcriptional regulator