PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G21100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HSF
Protein Properties Length: 128aa    MW: 14238.5 Da    PI: 5.0771
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G21100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind33.11.5e-10711111353
                      GGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHH CS
     HSF_DNA-bind  13 eelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSF 53 
                      ++++++i w+++g++f+v+ ++efa ++Lp+yFkh+  + F
  OPUNC03G21100.1  71 KTVDDIILWNDDGSTFIVWRPDEFACDLLPTYFKHNFSTEF 111
                      5789*******************************976666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004150.007564122IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467859.11E-870112IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.101.1E-971112IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004475.7E-871112IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MGHSLEKWPA LPQLKQFMFV VPEPGMVEVG VRSIAAGRTV VVTWEPSPPP PALAAEALGQ  60
QRIVPTPFLT KTVDDIILWN DDGSTFIVWR PDEFACDLLP TYFKHNFSTE FCLGLPGNVA  120
RWIGYKGI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2321471e-43AC232147.1 Oryza minuta clone OM__Ba0142L21, complete sequence.
GenBankAC2321411e-43AC232141.1 Oryza minuta clone OM__Ba0168B23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149902.14e-19heat shock factor protein 7
RefseqXP_008677301.14e-19PREDICTED: heat shock factor protein 7 isoform X1
TrEMBLA0A0E0KFE15e-91A0A0E0KFE1_ORYPU; Uncharacterized protein
STRINGBGIOSGA011509-PA7e-19(Oryza sativa Indica Group)
STRINGGRMZM2G098696_P021e-18(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11660.12e-18HSF family protein