PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G18730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CAMTA
Protein Properties Length: 1003aa    MW: 112603 Da    PI: 5.9767
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G18730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1178.21e-55221373118
             CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                      + kkrwl+++ei++iL n+++++l++e+++rp sgsl+L++rk +ryfrkDG++w+kkkdgktv+E+hekLK g+++vl+cyYah+een++fqr
  OPUNC03G18730.1  22 EAKKRWLRPTEICEILSNYRSFSLSAEPPNRPGSGSLFLFDRKTLRYFRKDGHNWRKKKDGKTVKEAHEKLKAGSIDVLHCYYAHGEENENFQR 115
                      459******************************************************************************************* PP

             CG-1  97 rcywlLeeelekivlvhylevk 118
                      r+ywlLee++++ivlvhylevk
  OPUNC03G18730.1 116 RTYWLLEEDFTHIVLVHYLEVK 137
                      *******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143780.39716142IPR005559CG-1 DNA-binding domain
SMARTSM010764.3E-7619137IPR005559CG-1 DNA-binding domain
PfamPF038592.0E-4922136IPR005559CG-1 DNA-binding domain
CDDcd001020.0015449537No hitNo description
Gene3DG3DSA:2.60.40.103.4E-7449536IPR013783Immunoglobulin-like fold
SuperFamilySSF812965.95E-18450535IPR014756Immunoglobulin E-set
PfamPF018331.3E-7450535IPR002909IPT domain
SuperFamilySSF484032.33E-12626713IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-11640715IPR020683Ankyrin repeat-containing domain
CDDcd002045.77E-8641711No hitNo description
PROSITE profilePS5029711.665647693IPR020683Ankyrin repeat-containing domain
SuperFamilySSF525401.33E-8819877IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.0082826848IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.791827856IPR000048IQ motif, EF-hand binding site
PfamPF006120.0054828847IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0051849871IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.267850874IPR000048IQ motif, EF-hand binding site
PfamPF006123.0E-4852871IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1003 aa     Download sequence    Send to blast
MAETRKFLMP NQPPDISQMV LEAKKRWLRP TEICEILSNY RSFSLSAEPP NRPGSGSLFL  60
FDRKTLRYFR KDGHNWRKKK DGKTVKEAHE KLKAGSIDVL HCYYAHGEEN ENFQRRTYWL  120
LEEDFTHIVL VHYLEVKGVK QSFSRAKEEI MQLSGADSPS CSNSITSQNQ MAPQIMDAAE  180
SPISGQISEY EGAEPAKFGA ADNCRASSRY NPLIEMQQPL DGIMMDNILY PSASAICNQV  240
SGYHGELPPG TSNLNGHTFT HSDIARMFDD SSSGLRDISR TLFDSMPYDE HFSGYANGFI  300
EPTLYSSFSM IEANNLEDSS LLETFTSEAL YTNNLSQKEA DALSFAGISS PEVNGNNYTE  360
GSTKHPLLKQ LSLDLFKIES SGLKKHDSFS RWMSKELGEV VDLDIKSSSD ALWSSIEIVN  420
AADGPSAPTN EQLDAYAVSP SLAQDQLFSI LDISPSFSYI GSKTKVLVTG TFLASEENVE  480
NCKWSCMFGD VEVPAEVLAD GALRCYAPEH QSGRVPFYVT CSNRIACSEV REFEYWDSDA  540
QYMETSHSQA NGINEMHLQI RLEKLLSLGP DDNQLLVCGN EKLELIDAIN SLMLDEKWSD  600
QGSPSGSKDV VTPRNQSLKK LMKEKLHCWL IYKINDCEKG PNILGKEGQG VIHLVAALGF  660
DWAIRPILVA GVNVNFRDAH GWTALHWAAS CGRTPADLAS TNGHKGIAGF LAESALTSHL  720
SALTLKDSKD SNVEEACGST SPEDLPEMNS SQLAVEDSHA ELLKDSLTAV RKSTQAAARI  780
FQAFRVESFH RKKVVEYGDD DCGLSDEHTF SLISLQKFKQ GQHDTRLHSA AVRIQNKFRG  840
WKGRKEFMII RQRIVKLQAH VRGHQVRKNY KKVVWSVGIV EKVILRWRRK GRGLRGFRPE  900
KQLEGQTQIQ PAKTEDEYDY LQDGRRQAEA RLQRALDRVR SMTQYPEARE QYRRLTTCVA  960
EMQQSRMMQD EMLSEAAGAD GSDFMNGLED LICRDDPKMS AIW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0703500.0AK070350.1 Oryza sativa Japonica Group cDNA clone:J023052K16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631089.10.0PREDICTED: calmodulin-binding transcription activator 3 isoform X1
TrEMBLA0A0E0KEI20.0A0A0E0KEI2_ORYPU; Uncharacterized protein
STRINGBGIOSGA012779-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60838140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.20.0ethylene induced calmodulin binding protein