PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G15320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 325aa    MW: 32980.6 Da    PI: 7.9482
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G15320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.62.8e-153898257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  OPUNC03G15320.1 38 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 98
                     89*****************99*************************************997 PP

2Wus_type_Homeobox106.81.3e-3437100265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
    OPUNC03G15320.1  37 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 100
                        589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2563499IPR001356Homeobox domain
SuperFamilySSF466893.98E-1434106IPR009057Homeodomain-like
SMARTSM003891.2E-636103IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-838105IPR009057Homeodomain-like
PfamPF000465.3E-133898IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEGSSNSPDQ QSSGGSPEER GSGGSGGGGG RGAGEPVRSR WTPKPEQILI LESIFNSGMV  60
NPPKDETVRI RKLLERFGAV GDANVFYWFQ NRRSRSRRRQ RQMQAAAAAA AAAAAAASSS  120
SPSANTSPAA ASATVQVGLP SGAVVHTMAM GGSACQYEQQ ASSSSSSGST GGTSSLGLFA  180
HGAGASGGYL QASCGASASA SSALAPGLMG DVDSGGSDDL FAISRQMGFV GSPRCSPASP  240
ATPSSAATAA QQQFYSCQLP AATITVFING VPMEVPRGPI DLRAMFGQDV MLVHSTGALL  300
PVNDYGILMQ SLQIGESYFL VARQT
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0632620.0AK063262.1 Oryza sativa Japonica Group cDNA clone:001-113-A08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796618.11e-132WUSCHEL-related homeobox 6-like
SwissprotQ10M291e-131WOX6_ORYSJ; WUSCHEL-related homeobox 6
TrEMBLA0A0E0KD660.0A0A0E0KD66_ORYPU; Uncharacterized protein
STRINGOPUNC03G15320.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.29e-29WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]