PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G09650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 719aa    MW: 78905.3 Da    PI: 6.3345
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G09650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.71.3e-081456347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E++ + +a +q G++ +++I  +++  ++  q++++++ +
  OPUNC03G09650.1 14 AWTRQEEQNFFNALRQVGKN-FEKITLRVQ-SKSKDQVRHYYYRL 56
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-91060IPR009057Homeodomain-like
PROSITE profilePS5129313.1551061IPR017884SANT domain
SMARTSM007175.2E-71159IPR001005SANT/Myb domain
PfamPF002493.5E-71456IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-51463IPR009057Homeodomain-like
CDDcd001671.06E-61457No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MSLVRSAPAR QWAAWTRQEE QNFFNALRQV GKNFEKITLR VQSKSKDQVR HYYYRLVRRM  60
KKLLGPEFSL DAKNSKDTIA AMLCWWSLLE KFSCSASKLH LKPRRFKTFV EALGNQLLKD  120
RNKTRKKCPR GDVCLSSSSS SLNRTPGNES FAVKLLSVDV SNGSKVGSSK GSFFKKVTEP  180
NCNNKSGATK GDLSATRTVK QKRRAGGVVA SAAYKKWERA AMAGVSLVAD AAEELERNTV  240
NADARMLSPS SSNFCTVDGL GTNHIKEADQ QAPAKLKLQL FPINEATRKA LEKDEHNPHL  300
ELTLSARKKI SSVLEHLNRK WGNSNIASGE LLLFPYCAHQ EDLATYQRWT TKDTVAVADV  360
FLSVNSPSVF RLRYGWFSLA ELEAGVSEIS LTHFENCLIP EDIHAKSPSE ACVQKDGNSV  420
SSCAPEQHPC SSKDQSALLL AIPSSTGKSA QVPEQCIDVP PSQFGRQNQD QVTTNQVFEV  480
DQGMDCAAVS EGEWADTLTD ISVGYLLTEA SRGVNTDCPG TSVVKNTLFL ENPCSYDSFD  540
AAVALHASRY KSAEQPALAS HSTIWGAEET CDAFSFNLAA SRKQECSNNS VSSSPDNDSD  600
VYPSNSKGFQ GFLQDLAGAE VADNPCIDDA KDIESLCAES PPRSDNDTAP KDQSLADLYW  660
PDSLGPLDLE IPSATYHADD LLLGDGQNSW NRMMANSLDA FRNLSFFTAD KNDSIPSIM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1026880.0AK102688.1 Oryza sativa Japonica Group cDNA clone:J033102O16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632626.10.0PREDICTED: TSL-kinase interacting protein 1
RefseqXP_015632627.10.0PREDICTED: TSL-kinase interacting protein 1
TrEMBLA0A0E0KB400.0A0A0E0KB40_ORYPU; Uncharacterized protein
STRINGORGLA03G0096900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54783643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.21e-162TSL-kinase interacting protein 1