PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G07840.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 266aa    MW: 30080.7 Da    PI: 8.6197
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G07840.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.18.1e-1915109199
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      ffk+      +++  l lp kfa+e g  + ++ +l++     r W+vk+  +   g ++l++GW+eF++a++L++g f+vF++dg   f  +v
  OPUNC03G07840.3  15 FFKII--LPGSSRTKLKLPDKFARELGDRELRDAKLQVAGAGRRLWDVKVFDDDVNGDVYLGRGWQEFARAHDLRDGHFLVFRYDGAAAF--TV 104
                      66777..556667779**********99999*******************65667777**************************998888..99 PP

                      EEE-S CS
               B3  95 kvfrk 99 
                      +vf++
  OPUNC03G07840.3 105 TVFDE 109
                      99986 PP

2B3491.1e-151672391487
                      T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      + l +p +f e+hg+ k+e  +++l   +g+ W+v+l++  r +++r+ ++ GW +F+ +ngL +gD++ F++ ++
  OPUNC03G07840.3 167 QYLNVPVEFQEAHGYAKRE--KVVL-RMRGEPWTVRLKHsrRERGQRTAFRYGWHRFCVDNGLAVGDTCFFRVLRE 239
                      45889********999876..4554.4599*******9876667777*************************6654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.84613110IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-1913116IPR015300DNA-binding pseudobarrel domain
CDDcd100171.33E-2013108No hitNo description
Gene3DG3DSA:2.40.330.101.5E-2114112IPR015300DNA-binding pseudobarrel domain
PfamPF023622.6E-1515109IPR003340B3 DNA binding domain
SMARTSM010194.2E-1615110IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-25150260IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.02E-16151242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.79E-11152235No hitNo description
SMARTSM010196.5E-8152261IPR003340B3 DNA binding domain
PROSITE profilePS5086312.012154261IPR003340B3 DNA binding domain
PfamPF023623.2E-13168239IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEEQMANLRL TDFEFFKIIL PGSSRTKLKL PDKFARELGD RELRDAKLQV AGAGRRLWDV  60
KVFDDDVNGD VYLGRGWQEF ARAHDLRDGH FLVFRYDGAA AFTVTVFDET MCRRNYRRGQ  120
HDPADSGSSS SSDGSDAATA VEGVGDVAAS QFAVTLRQCN LGDKQAQYLN VPVEFQEAHG  180
YAKREKVVLR MRGEPWTVRL KHSRRERGQR TAFRYGWHRF CVDNGLAVGD TCFFRVLREG  240
DLRRGGGGDD HVLRVAVRKA DGTTLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0708610.0AK070861.1 Oryza sativa Japonica Group cDNA clone:J023073O05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628624.11e-156B3 domain-containing protein Os03g0212300
SwissprotQ10Q261e-157Y3123_ORYSJ; B3 domain-containing protein Os03g0212300
TrEMBLA0A0E0KAF50.0A0A0E0KAF5_ORYPU; Uncharacterized protein
STRINGONIVA03G08950.11e-158(Oryza nivara)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.12e-20B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]