PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G02270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 995aa    MW: 110082 Da    PI: 5.3124
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G02270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.43e-28625675252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  OPUNC03G02270.1 625 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 675
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029614695IPR003035RWP-RK domain
PfamPF020427.4E-26627675IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.0E-25847931No hitNo description
SuperFamilySSF542771.69E-22847931No hitNo description
SMARTSM006665.8E-25849932IPR000270PB1 domain
PROSITE profilePS5174522.272849932IPR000270PB1 domain
PfamPF005646.8E-17850931IPR000270PB1 domain
CDDcd064071.15E-42850931No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 995 aa     Download sequence    Send to blast
MEQKPPPLSP PRRDEEEDGS LGCGMSGTGD IAAGDLDLME EFLLATPGLD LTEFWHPGAS  60
PGAASPFSPL FDIGSSVTTL TPPAPAAGED DKDEAEMPSR GGGGGGGLEV SPAYRGWTLQ  120
TAPQVAAVEP TVKERLRRAL ERIASQSQAQ RGDGELLVQV WVPTRIGDRQ VLTTCGQPFW  180
LDRRNQRLAS YRTVSMKYQF SADESARADL GLPGRVFVGR VPEWTPDVRY FSTEEYPRVQ  240
HAHYFDIRGS VALPVFEPRS RACLGVVELV MTTQKINYSA EIENICNALK EVDLRSSDVS  300
SDPRSKVVDA SYRAIIPEIM DVLRAVCDTH NLPLAQTWIP CICQAKGGSR HSDESDKHCV  360
STVDEACYVR DHSVLGFHQA CSEHHLFRGE GVVGRAFGTN EPCFSPDITT YSKTQYPLSH  420
HAKLFGLRAA VAIRLRSVKT GSLDFVLEFF LPMKCINTEE QRAMLNSLSN TIQEVCYTLR  480
VVKPKELLND GPFEISQPTR PEFYAKSVHE NLDELCSGIN VPGRTISLEA SEEVSSWIAS  540
LVDAQNKGGK GEIDVDLPFG FSKQDDEGFS VTAGWHTSPA IAPDGSMFSG FKQHEDYDVK  600
ENTCSSDPSN SNSDKAVEKR RTKTEKTVSL QDLRKHFAGS LKEAAKNLGV CPTTLKRICR  660
QHGINRWPSR KIKKVGHSLK KLQMVIDSVH GPEGTVQLSS LYENFTKTTW SERELQGDVD  720
FPASEQNFQL EPSVPDRPCE GRFTSHTSGS NSISPSCSQS SNSSLGCSSG PKPQQQHGSA  780
PQLAVKEEIS MDENHCSTLI KSASHAEVEL QMFVEERPTM LFRSHSQVLL SEHKLIENMS  840
NVQKARSDSL KIKAIYGEER CIFRLQPSWG FQRLKEEIVK RFGIAQDTHM DLKYLDDESE  900
WVLLTCDADL LECIDVYKSS SNQTVRILVN PSTQPLLNAS FGQTGKECLM LPSVVSQDWH  960
TQASDLDTWA EVQTNGQLPA DVAVEPCCVL ELEMR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000460.0AK100046.1 Oryza sativa Japonica Group cDNA clone:J013153P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629744.10.0protein NLP1
RefseqXP_015629745.10.0protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A0E0K8C40.0A0A0E0K8C4_ORYPU; Uncharacterized protein
STRINGOPUNC03G02270.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]