PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G29040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 450aa    MW: 49198.9 Da    PI: 5.9965
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G29040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.52.7e-081758338
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                     +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  OPUNC02G29040.1 17 ARACDSCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 58
                     578*****************************6567777776 PP

2CCT68.41.9e-23395438144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+ 
  OPUNC02G29040.1 395 REARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRH 438
                      9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7221562IPR000315B-box-type zinc finger
SMARTSM003361.6E-111562IPR000315B-box-type zinc finger
PfamPF006433.3E-71859IPR000315B-box-type zinc finger
CDDcd000211.26E-82062No hitNo description
PfamPF062036.7E-18395437IPR010402CCT domain
PROSITE profilePS5101716.122395437IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MSCSLEKAAG AVGGKAARAC DSCLRRRARW YCAADDAFLC QGCDTSVHSA NPLARRHERL  60
RLRASSPPPL TARASVEEEE AAVAGTTASK RQGGVTPAWS KRKARTRRPQ VKSVGQLLSR  120
RLDVPEMAVE SSDERKADED GAPEELEGQL LYRVPVFDPS LAEFCSPPPI DDAVAASSSC  180
LKEDSADGAV EDTKYPAAAP SSPVQQLPDS FINFEPTDAE LREFAADMEA LLGQGLDDSN  240
ELQDSFYMET LGLITPPLEE SGRVKMEPDG GVASNSRVSL PSCRPQPKPE EESADVLDID  300
FNCTSPDEQK SSASNGAAAD SQFFQRSLDL RLNYEAVIES WSNSPWTDGR RPHGQLDDFW  360
PNDHHYSGLW AAGGGGHGAE AGMMTVRPRM DGPGREARVT RYREKRRTRL FSKKIRYEVR  420
KLNAEKRPRM KGRFVKRHST AAAAAPCAVT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405421RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1203140.0AK120314.1 Oryza sativa Japonica Group cDNA clone:J013055L13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622659.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0E0K4V90.0A0A0E0K4V9_ORYPU; Uncharacterized protein
STRINGLOC_Os02g49880.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0268200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-42B-box type zinc finger protein with CCT domain