PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G25720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 624aa    MW: 64994.4 Da    PI: 9.486
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G25720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS307.62.9e-942606242374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A av +g++++a +lL+ l+  a+p+gd+ qRl+a+++ AL++r+           p+++ ++  s e+ aa +l+++vsP++ ++ 
  OPUNC02G25720.1 260 RQLLSEAAAAVVDGNHTAAASLLSALKLSANPRGDAEQRLVAVMVAALSSRVGT--------APSQHLADIYSGEHRAACQLLQDVSPCFGLAL 345
                      689*************************************************98........5666666666999999**************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakr 185
                        aN aIl+av+g++++H +Dfd+s  +Q +aL++aLa+R+ ++ sl++T+v++p+s      +++l +t erL+k+A++ g++f+f++ v+ r
  OPUNC02G25720.1 346 HGANLAILDAVAGHRAIHLVDFDVSA-AQHVALIKALADRRVPATSLKVTVVADPTSPftpaMTQSLAATSERLKKLAQQAGIDFRFRA-VSCR 437
                      ************************85.8**************************9988899999*************************.7889 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       +++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ ++ l P+vv++veqe+++n+++ ++rf++a  +y a+++sl+a+l+r+s
  OPUNC02G25720.1 438 AAEIEASKLGCEPGEALAVNLAFTLSRVPDESVSPANPRDELLRRMRALGPRVVTLVEQELNTNTAPMAARFSDASAHYGAVLESLDATLGRDS 531
                      ********************************************************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       +r+  E++ l++++ n+v  eg +r+er+e ++kWr+r+++aGF++v+++e++a+ +++ l       + v+ ++g l  gW++r ++++SaW
  OPUNC02G25720.1 532 ADRARAEAA-LANKVANAVGREGPDRVERCEVFGKWRARFGMAGFRAVAIGEDIASRVRARLGPAL-PAFDVKLDNGRLGVGWMGRVVTVASAW 623
                      ********9.9***************************************************9998.66************************* PP

             GRAS 374 r 374
                      r
  OPUNC02G25720.1 624 R 624
                      8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.76233605IPR005202Transcription factor GRAS
PfamPF035141.0E-91260624IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MDPAGAPWCD PRRGYGGYGV GSAAVRQQSQ QPRSDSVGGA AVTGGVLKRS LGEMERWQKQ  60
RQVAAQQAMY LRSVRQRTGA LQPMDIGSVL GGAAGSPSPA YGISSFSSGF GGISPQPSST  120
LSSLTTASRT VMPGMQQQQL QRRMMSVPAP QNQAVGRAPA ARPATATELV LLQELEKQLL  180
GDDDEADAAG SVCGSGITSS DWGDTIQRLN SVTAASSPSL ALPNTVNNTA LLARSPTNSS  240
SSTASSSASS SPPISAASSR QLLSEAAAAV VDGNHTAAAS LLSALKLSAN PRGDAEQRLV  300
AVMVAALSSR VGTAPSQHLA DIYSGEHRAA CQLLQDVSPC FGLALHGANL AILDAVAGHR  360
AIHLVDFDVS AAQHVALIKA LADRRVPATS LKVTVVADPT SPFTPAMTQS LAATSERLKK  420
LAQQAGIDFR FRAVSCRAAE IEASKLGCEP GEALAVNLAF TLSRVPDESV SPANPRDELL  480
RRMRALGPRV VTLVEQELNT NTAPMAARFS DASAHYGAVL ESLDATLGRD SADRARAEAA  540
LANKVANAVG REGPDRVERC EVFGKWRARF GMAGFRAVAI GEDIASRVRA RLGPALPAFD  600
VKLDNGRLGV GWMGRVVTVA SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-382556241375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2244260.0AY224426.1 Oryza sativa (japonica cultivar-group) isolate 20145 scarecrow transcriptional regulator-like protein mRNA, complete cds.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041780.0AP004178.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1123_G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0K3N20.0A0A0E0K3N2_ORYPU; Uncharacterized protein
STRINGORGLA02G0240700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-86SCARECROW-like 8