PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G17440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 325aa    MW: 35254.7 Da    PI: 7.9861
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G17440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.88.7e-071902391463
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R + +rsR RK+++i+ Le+ v++L++   +L+ ++ +l ++  +l +e+
  OPUNC02G17440.1 190 RRSGQRSRVRKLQYIADLERTVDSLQNIGADLAVRVASLFQLRNALSMEN 239
                      67889***************************999999999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147037.28E-16189233No hitNo description
Gene3DG3DSA:1.20.5.1706.4E-7190251No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSLFTQSC RFPSEDPFVG EPPCWLDDLL ADSGKSHNFP  60
PLRRACSDSD AILDVLTTFQ SPIYPIDEGD LQLVGEAGDS FNAVAEGGGS GAGIEGSCVY  120
GPNSPRQKTR LTSSESSMVN AVLENVPSNP LQYLMIDATS GVTCNVGAAN GTGETGDAVC  180
HADQEKSLKR RSGQRSRVRK LQYIADLERT VDSLQNIGAD LAVRVASLFQ LRNALSMENK  240
QLRRQITSLQ QAKLIKDGQT QMLKKETERL KQLSVRHRRS RSVTSCFEAK SFGGGDPSAI  300
NWQMLDMSKL SLNGGGVPPR GGYGM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195RRSGQRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3248080.0HQ324808.1 Oryza sativa Japonica Group clone KCS608G03 b-zip protein mRNA, complete cds.
GenBankAK0636440.0AK063644.1 Oryza sativa Japonica Group cDNA clone:001-118-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623493.10.0PREDICTED: basic leucine zipper 34
TrEMBLA0A0E0K0S50.0A0A0E0K0S5_ORYPU; Uncharacterized protein
STRINGORGLA02G0167300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-18bZIP family protein