PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G12490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 851aa    MW: 94569 Da    PI: 4.7679
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G12490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding223.8e-07700741144
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      r +W++ + +l++++ +q+G++ ++ I + ++  ++++q++ ++
  OPUNC02G12490.1 700 RAKWSKSDTDLFYQGLQQFGSD-FTMIQHLFP-DKSRNQVRQKF 741
                      569*******************.*********.********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-9691747IPR009057Homeodomain-like
PfamPF159634.9E-25693774No hitNo description
SMARTSM007177.0E-8699747IPR001005SANT/Myb domain
CDDcd001677.15E-6702742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MIDDEADFGN ITDAAVEGQA AAKFRPKARA KPRKTSLPSR SLAPHPTVES TDEKVETLNT  60
DSTSQEQSVD KKAAPLGCHG SETDGNACAS GGILDTPSED VVTVSLGLVN NPDVTLDSST  120
VCAPSVHKIS QNEENNDDLS HVATHKESMV VSDTQAPPTC RSANTIDDLA DFEGLCDDTQ  180
VEEERIAKFQ PKIRVKTSKA AWKSQRTNQK AGTSTVDVIS QNKEDGKDKA GCNDKQLRPP  240
TRHQKNVQIS YSQAHLGTHN STIDDVANSH SIMEEPAQEE MAAKFQPKLR PKAGGASPGV  300
AETIDAACVA TPEFGVSSVD VVSQDTEEDS HREGLSDDSC QKYMDEEAIT ASGTGPPQDL  360
DANVDLDSHA EMVNPHPDGS PLIIGEPSVE TTVKFQPYVR RKKGKGKSVS FVPPNVSHAH  420
APTDTNSETS NFSHFCKDIA TGESLSNLPQ QASEKVCING EHHPDDQECN DPENQYHEGE  480
PSDHVIEQEP ERDVRETGTS MILRNRGKIQ KDGIPEHTAD DNMDEDFGEP PSDEQDIDSG  540
DEYTARGKQK GRRKSREKNV NKEPSRGTKR TSGDSTIEES QKQKLQKNKS KASSVGQKKT  600
SKDSSVKQPE KKLTHRIRRK RMEEVKTLLE TPDHEIDRMK LSGKEIPSGP SSSNHSISQF  660
GDMDEEYNEQ DNWDNDRTEN HVVENATKLN YHSYMNRQTR AKWSKSDTDL FYQGLQQFGS  720
DFTMIQHLFP DKSRNQVRQK FKAEEKKHPM QVHDAIMHRS RDNLYFKKVI KQLNIEDVQP  780
DINNTHEQEG ASNEEDPGTK NIPGGLINEE ENGLDWSDKE LDMHRSEVEE KEHVSTNDDD  840
DDDLGDVFDW Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0968560.0AC096856.7 Oryza sativa chromosome 3 BAC OSJNBa0075M12 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633004.10.0PREDICTED: uncharacterized protein LOC9267825
TrEMBLA0A0E0JZ080.0A0A0E0JZ08_ORYPU; Uncharacterized protein
STRINGBGIOSGA009478-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-34MYB_related family protein