PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G05140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 405aa    MW: 41931.1 Da    PI: 6.129
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G05140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.61.1e-0760105342
         zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                       ++C+ +e  ++   C+ +   lC+ C + +H        H++vp+
  OPUNC02G05140.1  60 VWVCEVCELAPAAVTCKADAAALCAACDSDIHDAnplarrHERVPV 105
                      689*****************************44788888999986 PP

2CCT67.63.3e-23319362144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      R+ +l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k+a
  OPUNC02G05140.1 319 RASRLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRA 362
                      899***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0321362IPR000315B-box-type zinc finger
PROSITE profilePS5011910.60858105IPR000315B-box-type zinc finger
PfamPF006431.7E-559105IPR000315B-box-type zinc finger
SMARTSM003362.8E-863105IPR000315B-box-type zinc finger
PfamPF062033.6E-17319361IPR010402CCT domain
PROSITE profilePS5101716.638319361IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MEMELGLGRY WGFGGRRCGA CAVAPAAVHC RTCDGGGGGG GGYLCAGCDA EHGRAGHERV  60
WVCEVCELAP AAVTCKADAA ALCAACDSDI HDANPLARRH ERVPVQPIGS ASAAAAPDAL  120
LFGGEKDVAA VDLTTGAVGG GVGKEVKLDF LFADFMDPYL GGSPELARFP HADSVVPNGS  180
TGPAMELGFA AVVKPSYSSY TAASLGNSVS ACSSLPRSRQ ESLDLALAYS IDHLHLQFII  240
LSIEQGSSSE VGLVPDAICG GGGGIIELDF AQSKAAYLPY ASTPSHSMSS SMDVGVAPEM  300
SDGAAAGRAY AAAAAAEGRA SRLMRYREKR KNRRFEKTIR YASRKAYAET RPRIKGRFAK  360
RADDHDGDNH GETDAASPAP AAAAPPPPQQ QTMLDFAGYG VVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0048380.0AP004838.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0504A05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623284.11e-156PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0JWB10.0A0A0E0JWB1_ORYPU; Uncharacterized protein
STRINGORGLA02G0054600.11e-156(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-19CONSTANS-like 4