PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G42220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 1231aa    MW: 133153 Da    PI: 7.3281
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G42220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB139.77.7e-44495394
            NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                      qd++lPianv+rimk  lP +akisk aket+qec++efisfvt+eas++c+re+rkt+ngdd+++a+ +lG+++y+++++ yl++yre e
  OPUNC01G42220.1  4 GQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERRKTVNGDDICHAMRSLGLDHYADAMHRYLQRYREGE 95
                     69***************************************************************************************976 PP

2zf-C2H217.31.3e-05261283123
                      EEETTTTEEESSHHHHHHHHHHT CS
          zf-C2H2   1 ykCpdCgksFsrksnLkrHirtH 23 
                      ++C++Cgk F r  nL+ H r H
  OPUNC01G42220.1 261 FVCEICGKGFQRDQNLQLHRRGH 283
                      89******************988 PP

3zf-C2H211.10.0013371389523
                      TTTEEESSHHHHHHHHHHT CS
          zf-C2H2   5 dCgksFsrksnLkrHirtH 23 
                      dCg++Fsr++++++H   +
  OPUNC01G42220.1 371 DCGTVFSRRDSFVTHRAFC 389
                      9**************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.4E-403101IPR009072Histone-fold
SuperFamilySSF471138.55E-325103IPR009072Histone-fold
PfamPF008083.1E-23972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.3E-123654No hitNo description
PROSITE patternPS0068503955IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.3E-125573No hitNo description
PRINTSPR006153.3E-127492No hitNo description
SuperFamilySSF576677.83E-6260283No hitNo description
SMARTSM003550.012261283IPR015880Zinc finger, C2H2-like
Gene3DG3DSA:3.30.160.603.9E-5261283IPR013087Zinc finger C2H2-type/integrase DNA-binding domain
PROSITE profilePS5015711.614261283IPR007087Zinc finger, C2H2
PROSITE patternPS000280263283IPR007087Zinc finger, C2H2
SMARTSM00355240306336IPR015880Zinc finger, C2H2-like
SuperFamilySSF576677.83E-6336361No hitNo description
SuperFamilySSF534743.33E-39661915IPR029058Alpha/Beta hydrolase fold
Gene3DG3DSA:3.40.50.18206.5E-65662918IPR029058Alpha/Beta hydrolase fold
PfamPF126978.3E-15665910IPR000073Alpha/beta hydrolase fold-1
SuperFamilySSF534745.28E-8932996IPR029058Alpha/Beta hydrolase fold
Gene3DG3DSA:3.40.50.18208.1E-17936992IPR029058Alpha/Beta hydrolase fold
PfamPF126976.8E-119411220IPR000073Alpha/beta hydrolase fold-1
SuperFamilySSF534744.09E-299881229IPR029058Alpha/Beta hydrolase fold
Gene3DG3DSA:3.40.50.18202.0E-489931230IPR029058Alpha/Beta hydrolase fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1231 aa     Download sequence    Send to blast
MTNGQDNLLP IANVGRIMKD GLPPQAKISK RAKETIQECA TEFISFVTGE ASERCRRERR  60
KTVNGDDICH AMRSLGLDHY ADAMHRYLQR YREGEELAAS LNNAGGGAGS RGGGAIQIDV  120
RAELSIFRGN NQGRAVVVDG ARWAERFGLY LLHGLDRPCY DERTVGQRRQ SENQQRRWKK  180
QLMEEFEMQQ PYYSKLLLDG PLKIASVDES DLQLVAGVSS DPPPAPPPAV KKKKRSLPGT  240
PDPSAEVVAL SPRTLLATNR FVCEICGKGF QRDQNLQLHR RGHNLPWKLR QRGAGGAGEP  300
PRKRVYVCPE ASCVHHSPSR ALGDLTGIKK HFCRKHGEKK WKCDRCCKRY AVHSDWKAHS  360
KVCGTREYKC DCGTVFSRRD SFVTHRAFCD ALAQENNKLA QPMNMAAVTS ALQGQQQAHH  420
LVLPSQPVSD DDDAAGYGLA ADVKSPHLKM FPDVDNTPLL PALSMAGCML SSLGARAAPS  480
SSSPFLHIHG RNLGMDAPSD AATGFPPPAA GSAAIMSATA LLQKAAELGA TTSTSCYGGV  540
AFPSMGIAGG IDRIPTIGHH LGPYDDVVPA ALGQTATQLV GFDLGGLLPG QLYGGGGAMT  600
RAIGSLMHGG DQHVGVVDRR RGEGVRVVDY MGVDDDDHGS FDGRVLEDSQ VKYSDFRMED  660
GGKHFVFVHG LGHGAWCWYR VVAALRAAGH RATALDMAAA GAHPARLDEV RSFEEYSRPL  720
LDAVAAAAPG ERLVLVGHSL GGLNLALAME RFPDKVAAAV FLAACMPSAG KHMGITLEEF  780
MRRIKPDFFM DSKSIVLNTN QEPRTAVLFG PKLLAEKLYN QSPPEDLTLA TMLVRPGTNY  840
IDDPIMKDQT LLTDGHYGSV KRVFVVAMDD ASSDEELQRW TIDMSPGVEV EEIAGADHMA  900
MCSKPRELCD VLLRIAANTK KRESKQLKMD ISSSSSKKHF ILVHGLCHGA WCWYRVVAAL  960
RAAGHRATAL DMAASGAHPA RVDEVGTFEE VVAALRAAGH RATALDMAAS GAHPARVDEV  1020
GTFEEYSRPL LDAVAAAPAG ERLVLVGHSH GGLSLALAME RFPDKVAAAV FVAAAMPCVG  1080
KHMGVPTEEF MRRTAPGGLL MDCEMVAINN SQGSGVAINM GPSFLAHKYY QQSPAEDLAL  1140
AKMLVRPGNQ FVDDPVMKDE SLLTNGNYGS VKKVYVIAMA DSSSTEEMQR WMVEMSPGTD  1200
VEEIAGADHA VMSSKPSELR DILIKIANKY E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1y7i_B4e-7366212304259salicylic acid-binding protein 2
1y7i_A4e-7366212304259salicylic acid-binding protein 2
1y7h_H4e-7366212304259salicylic acid-binding protein 2
1y7h_G4e-7366212304259salicylic acid-binding protein 2
1y7h_F4e-7366212304259salicylic acid-binding protein 2
1y7h_E4e-7366212304259salicylic acid-binding protein 2
1y7h_D4e-7366212304259salicylic acid-binding protein 2
1y7h_C4e-7366212304259salicylic acid-binding protein 2
1y7h_B4e-7366212304259salicylic acid-binding protein 2
1y7h_A4e-7366212304259salicylic acid-binding protein 2
1xkl_D5e-7366212304259salicylic acid-binding protein 2
1xkl_C5e-7366212304259salicylic acid-binding protein 2
1xkl_B5e-7366212304259salicylic acid-binding protein 2
1xkl_A5e-7366212304259salicylic acid-binding protein 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZ342700.0Z34270.1 O.sativa (cv. Nohrin) Pir7b mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0JTD10.0A0A0E0JTD1_ORYPU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125542534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50700.11e-95indeterminate(ID)-domain 2