PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G36520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 200aa    MW: 22924.7 Da    PI: 8.3453
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G36520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.2e-201172157
                     TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     ++ R+++t+eq+++L elF+   r+ps+e++++++++l    +++ ++V++WFqN++a+e++
  OPUNC01G36520.1 11 KCGRWNPTAEQVKVLTELFRAgLRTPSTEQIQRISTHLsafgKVESKNVFYWFQNHKARERH 72
                     568*****************99**************************************95 PP

2Wus_type_Homeobox110.96.9e-361273364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       + RW+Pt+eQ+k+L+el+++GlrtP++e+iqri+++L+++Gk+e+kNVfyWFQN+kaRer++
    OPUNC01G36520.1 12 CGRWNPTAEQVKVLTELFRAGLRTPSTEQIQRISTHLSAFGKVESKNVFYWFQNHKARERHH 73
                       78**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.6E-41077IPR001356Homeobox domain
PfamPF000461.0E-171272IPR001356Homeobox domain
SuperFamilySSF466897.27E-121376IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-71471IPR009057Homeodomain-like
CDDcd000868.79E-51474No hitNo description
PROSITE profilePS5007110.1061873IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MEALSGRVGV KCGRWNPTAE QVKVLTELFR AGLRTPSTEQ IQRISTHLSA FGKVESKNVF  60
YWFQNHKARE RHHHKKRRRG ASSPDSGSND DDGRAAAHET DADLVLQPPE SKREARSYGH  120
HHRLMTCYVR DVVETEAMWE RPTREVETLE LFPLKSYDLE VDKVRYVRGS GGEQCREISF  180
FDVAASRDPP LELRLCSFGL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:12904206}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1022030.0AK102203.1 Oryza sativa Japonica Group cDNA clone:J033087F22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642985.11e-146WUSCHEL-related homeobox 9
SwissprotQ8W0F11e-147WOX9_ORYSJ; WUSCHEL-related homeobox 9
TrEMBLA0A0E0JR661e-147A0A0E0JR66_ORYPU; Uncharacterized protein
STRINGOPUNC01G36520.11e-148(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94113643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.12e-36WUSCHEL related homeobox 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Li S, et al.
    OsFIE2 plays an essential role in the regulation of rice vegetative and reproductive development.
    New Phytol., 2014. 201(1): p. 66-79
    [PMID:24020752]
  3. Chu H, et al.
    A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
    J. Exp. Bot., 2013. 64(17): p. 5359-69
    [PMID:24043854]
  4. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  5. Coudert Y, et al.
    Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation.
    New Phytol., 2015. 206(1): p. 243-54
    [PMID:25442012]