PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G35610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 296aa    MW: 31711.9 Da    PI: 10.0604
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G35610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651.1e-2044103357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       R+t+tkeq+ +Le l+++  r+p+ae++++++++l    +++ ++V++WFqN++a++++
  OPUNC01G35610.1  44 ARWTPTKEQIAVLEGLYRQgLRTPTAEQIQQITARLrehgHIEGKNVFYWFQNHKARQRQ 103
                      7*****************99**************************************96 PP

2Wus_type_Homeobox115.62.4e-3743105365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RWtPt+eQi +Le ly++GlrtP++e+iq+ita+L+e+G+ie+kNVfyWFQN+kaR+rqkq
    OPUNC01G35610.1  43 NARWTPTKEQIAVLEGLYRQGLRTPTAEQIQQITARLREHGHIEGKNVFYWFQNHKARQRQKQ 105
                        78***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.72239104IPR001356Homeobox domain
SMARTSM003892.3E-541108IPR001356Homeobox domain
PfamPF000462.4E-1844103IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-844103IPR009057Homeodomain-like
SuperFamilySSF466892.65E-1244110IPR009057Homeodomain-like
CDDcd000864.76E-54599No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
METTTTTTLG GGGGGRAGGF SDPPSPLSPP LSPASAAAAA LANARWTPTK EQIAVLEGLY  60
RQGLRTPTAE QIQQITARLR EHGHIEGKNV FYWFQNHKAR QRQKQKQQSF DYFSKLFRRP  120
PPLPVLHRPL ARPFPLALAP TAMPPPPPTT AACNAGGVMF RPPSFMPAAA NNAGYYPQQQ  180
TPVLYPGMEH EVCPNNKSMA QPPATTMYLT APISAHLAPA AGRGTGRETL QLFPLQPTFV  240
LPDHKPRRAG SACAAAVSLT TPSASASFSW ESESSDSPSS EAPPFYDFFG VHSGGR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032410.0AP003241.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0408C03.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644226.11e-111WUSCHEL-related homeobox 5
SwissprotA2WWU71e-112WOX5_ORYSI; WUSCHEL-related homeobox 5
SwissprotQ8LR861e-112WOX5_ORYSJ; WUSCHEL-related homeobox 5
TrEMBLA0A0E0JQV00.0A0A0E0JQV0_ORYPU; Uncharacterized protein
STRINGOPUNC01G35610.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.15e-28WUSCHEL related homeobox 2