PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G34140.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 265aa    MW: 29935.4 Da    PI: 6.5157
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G34140.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-2193153257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      r+R+t+t+ ql++Le+ F + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  OPUNC01G34140.2  93 RQRWTPTPMQLQILENIFDQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 153
                      89*****************99**************************************97 PP

2Wus_type_Homeobox103.41.6e-3392155265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
    OPUNC01G34140.2  92 ARQRWTPTPMQLQILENIFDQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 155
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-1888158IPR009057Homeodomain-like
PROSITE profilePS5007115.14389154IPR001356Homeobox domain
SMARTSM003891.0E-1491158IPR001356Homeobox domain
SuperFamilySSF466896.42E-1992156IPR009057Homeodomain-like
PfamPF000462.0E-1993153IPR001356Homeobox domain
CDDcd000862.93E-1493155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MEWDKAKASS AAAAGEAVDD RGGGEGLGYV KVMTDEQMEV LRKQISIYAT ICEQLVEMHR  60
ALTAQQDSIA GMRLGNLYCD PLMVPGGHKI TARQRWTPTP MQLQILENIF DQGNGTPSKQ  120
KIKEITSELS QHGQISETNV YNWFQNRRAR SKRKQAALPN NNAESEAEAD EESPTDKKPK  180
SDRPLHQNIA MRDHNTERIS EMHHFDTEHE QIRRMMYASN DSSSRSSGNL GQMSFYDNVM  240
SNPRIDHFLG KVESPGSFPH MRSVE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0685850.0AK068585.1 Oryza sativa Japonica Group cDNA clone:J013151P17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644908.11e-171PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM31e-168WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A0E0JQB30.0A0A0E0JQB3_ORYPU; Uncharacterized protein
STRINGOPUNC01G34140.10.0(Oryza punctata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.13e-70WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]