PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G30210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 626aa    MW: 68949.7 Da    PI: 5.9204
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G30210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ429.83.9e-1323275441217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p p+afl+pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip+cegaatakspwna+
  OPUNC01G30210.1 327 PVPAAFLRPKCALWDCPRPAQGSERWQDYCSMYHADLAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPVCEGAATAKSPWNAP 420
                      89*************************************9879*************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdl ++ege+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqps+s+ewhlyeyein++da+alyrle+
  OPUNC01G30210.1 421 ELFDLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINDCDAFALYRLEF 514
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d+kk+ak+k+++++l+++q++++rl+a
  OPUNC01G30210.1 515 KSSDAKKTAKSKLACNPLNEIQQQMVRLSA 544
                      ****************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MTASPPLIHP RGARASLLPR PSLLVASRGE VAPAAAHPPT QQSGSGRADQ KRKQNQQHDT  60
PLSSPRRRGG EQRRASLASN SLRPSAAPIG RDGARGGGDG EGPGRGAEMF SGLQSARKES  120
RSTDAAVLEA QLHQMLREWR AELSGNNNRE LSDPPSETLR LLQLAAAEEE EDDATSKLVE  180
QQQHPPSANQ AHGHAQGAQD MKPEPPEEAV ASPADLTVPQ SPGQGVLASG GGMLAPATAA  240
VFHDQMYYVN QELTVEDFLY DDNYKMYLPG SNPDVLNNLE STGQLEYPQF NLPQELPPNA  300
YLDMSNCGQN AGDVFLHMSD LLNTMSPVPA AFLRPKCALW DCPRPAQGSE RWQDYCSMYH  360
ADLAVKEEGP PGTMPVIRPR GIDLKDGPLF AALSAKIQGK HVGIPVCEGA ATAKSPWNAP  420
ELFDLYIFEG ESIREWLFFD KPRRAFESGN RKQRSLPDYN GRGWHESRKQ VMKDFGGLKR  480
SYYMDPQPSN SYEWHLYEYE INDCDAFALY RLEFKSSDAK KTAKSKLACN PLNEIQQQMV  540
RLSADSPVEN KRSARSRTKA NLNDINSNVY LVQSTTVQGS IPNAYQAVSQ ADQMTYLNGN  600
VVYGPHLPYG YSTERSDFYW SSNDGA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417650.0AK241765.1 Oryza sativa Japonica Group cDNA, clone: J065205E23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621735.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-138VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0E0JNS90.0A0A0E0JNS9_ORYPU; Uncharacterized protein
STRINGOPUNC01G30210.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-129vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]