PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G18590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 277aa    MW: 29288.8 Da    PI: 7.8772
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G18590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.7e-12125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  OPUNC01G18590.1 125 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 169
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.006566IPR017877Myb-like domain
SMARTSM007177.8968IPR001005SANT/Myb domain
PROSITE profilePS5129416.873118174IPR017930Myb domain
SuperFamilySSF466896.39E-17120175IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-17122172IPR006447Myb domain, plants
SMARTSM007172.3E-10122172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-11123168IPR009057Homeodomain-like
CDDcd001677.97E-10125170No hitNo description
PfamPF002496.5E-11125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MTSQATTTTA AAWTKEDDKA FENALAAGAA PPADGAPDDD WFAALAATVP GARSAEEVRR  60
HYEALVEDVA AIDAGRVPLP RYAGEESAAP PDGGHRREER KSGSGGYDGG KSCSKAEQER  120
RKGIPWTEEE HRLFLLGLDK FGKGDWRSIS RNFVISRTPT QVASHAQKYF IRLNSMNRDR  180
RRSSIHDITS VTAGEVAAQQ GPITGQATGN PAAALGPPGM KHPGGPPMPM YGGAPMGHPV  240
AGHMMPAAVG TPVMFPPGHA PYVVPVGYPA PPAKMHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0914931e-175FP091493.1 Phyllostachys edulis cDNA clone: bphyem204f04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455466.11e-141hypothetical protein SORBIDRAFT_03g011280
RefseqXP_003565794.11e-141PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H75e-52DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0JJM70.0A0A0E0JJM7_ORYPU; Uncharacterized protein
STRINGBRADI2G13860.11e-141(Brachypodium distachyon)
STRINGSb03g011280.11e-141(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94663041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.18e-55MYB family protein