PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G05570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 369aa    MW: 39272.2 Da    PI: 9.5228
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G05570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.3e-13112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  OPUNC01G05570.1 112 PWTEEEHRMFLMGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.8E-4223IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.565319IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.334105161IPR017930Myb domain
SuperFamilySSF466898.22E-17106161IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-19108160IPR006447Myb domain, plants
SMARTSM007172.6E-11109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-12109155IPR009057Homeodomain-like
CDDcd001674.92E-9112157No hitNo description
PfamPF002491.2E-10112156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNARTCPA RGGGGGGGGV RLFGVRLTSP PEVAMKKSAS MSCIASSLGG  60
GGGGGSGGSS PAAGGGVGGG GRGEGAAGYV SDDPTHASCS TNGRTERKKG TPWTEEEHRM  120
FLMGLQKLGK GDWRGISRNF VVSRTPTQVA SHAQKYFIRQ TNSSRRKRRS SLFDMVPEMP  180
MDESPVVVEQ LMLHSTQDEA TSSNQLPISH LVKQKEHEFA RHLSDLQLRK HEESEFTEPS  240
LAALDLEMNH AAPFKTKSVL TMPAFYPALI HVPLTLWPPN VANVGESGTN HEILKPTPVN  300
GKEVINKADE VVGMSKLTIG EGSSNSIEPS ALSLQLTGPT NTRQSAFHVN PPMAGPDLNK  360
RNNSPIHAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0716110.0AK071611.1 Oryza sativa Japonica Group cDNA clone:J023105I20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621787.10.0PREDICTED: transcription factor MYB1R1
TrEMBLA0A0E0JF220.0A0A0E0JF22_ORYPU; Uncharacterized protein
STRINGBGIOSGA002232-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g09280.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-74MYB_related family protein