PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA12G17050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 734aa    MW: 78772.1 Da    PI: 6.7558
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA12G17050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.48.9e-16461500241
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      ++k+C+CkkskClk+YCeCf+ag++Cse C+C++C Nk +
  ONIVA12G17050.1 461 SCKRCSCKKSKCLKLYCECFHAGVFCSEPCSCQGCLNKPS 500
                      689**********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.1E-15460501IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163417.699461553IPR005172CRC domain
PfamPF036387.8E-12463498IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MDTPDRPPRA AAAAAAAATA AVEDSPVFNF INSLSPIPPP KPSDSAHNVQ LFKSSDLAPV  60
SSIFASPHVN PAKESKLPIR EDSVQLSRES HSPNSVRTRT GATSSIIRMI RCKNIVSENC  120
SITCYLNDST SSKASQPIQL CGGSAESDTN QNTDGKKDPT TEQDRTDIEF VLLDQCGPEK  180
MDSSQSGNNA CENQLSEQHK DELGSFDGGY MFAHQPHSDM LRLAPPFESE TQLVNETLQT  240
DNVYCETLLT DGPSGSYTQN SAPDPHLYWA GAVEGCATDY TPQMLPGACQ SQLVPNDQIN  300
NKLNEPSDYM PMDHNVSSQN LRGMRRRCLF NEKSGAANKG AKNSSARHST NSTTPRRKIS  360
SSDNNLKTLR TPPCALPGIG LHLNALATVP KDKMVPHNDI QSSLNQASNV PSAVGSSPPT  420
DDPHTINDDS SQTAVVAYVG ESSQGSPKKK RHKFDNGDGT SCKRCSCKKS KCLKLYCECF  480
HAGVFCSEPC SCQGCLNKPS NMETVLSTRE QIESRNPLAF APKVIRTEPG QELAGGVGCS  540
MSCRCEGCKN AFGRREGVAL LGIEEAKRGC EEKDGGVKEE TTDNDKQLVI YQDSVNLTPA  600
ESVLATPSVV DYRPLVALPP LSSKKPRSST KLGGYSSRLE GHLKSDILLS PFESYAEMML  660
GDGTSNVLKG ESSPQTSVKV VSPNKKRVSP PRIGTGLSPI CKSGRKLILK SIPSFPSLGG  720
DITNEDPNTS SLAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0739420.0AK073942.1 Oryza sativa Japonica Group cDNA clone:J033075J10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620275.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A0E0JC560.0A0A0E0JC56_ORYNI; Uncharacterized protein
STRINGONIVA12G17050.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127462630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.12e-48Tesmin/TSO1-like CXC domain-containing protein