PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA12G17030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 329aa    MW: 36011.7 Da    PI: 5.998
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA12G17030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.23.9e-145390340
              TCR  3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                     +k+C+CkkskClk+YC Cfa+g++Cse+C C+ C Nk+
  ONIVA12G17030.1 53 CKSCSCKKSKCLKLYCVCFASGSHCSESCGCDPCYNKS 90
                     89**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.5E-95192IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163413.70652135IPR005172CRC domain
PfamPF036387.1E-105489IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGETPAPALL APAENASAEA AFAVPPAAIA AVVEANGNSE KKKKRKTDEG EGCKSCSCKK  60
SKCLKLYCVC FASGSHCSES CGCDPCYNKS IHGVPRSTPA LPLKAVQTLE TGQDSVGGAG  120
CSINCKCDDC KNPYGRKVGV ILDGKNILAG PTPNERNGTE ADSSDDEEDD YYMNRPLSPV  180
SPSPVSRESS FQQETLVGVE VQTMNGHLYP KPLTQVRPES WQLTRRPTEE VRGEAWHYLR  240
RPSEDGTSDV MEGHADPKFQ RDNKQLENHV DRYSIPRCIE VMNAMADLSP IEKSLAPDVF  300
LDPSNREIFL SLTVDIRTMW LKRKMKSLV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14045KKKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067180.0CU406718.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C103K09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618281.10.0protein lin-54
TrEMBLA0A0E0JC540.0A0A0E0JC54_ORYNI; Uncharacterized protein
STRINGONIVA12G17030.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP96102834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-11TESMIN/TSO1-like CXC 2