PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA11G23210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 949aa    MW: 106276 Da    PI: 6.3077
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA11G23210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS126.82.5e-392513972153
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lL++cA+a+++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+s+++ly+  +     +++ +e l+++kl+  ++ + k++ 
  ONIVA11G23210.1 251 RMLLIQCAQAMATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGSGKHLYQ--NHV---RMSLVEYLKVYKLYMAACCFKKVAL 339
                      679*********************************************************5..233...34489******************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg 153
                      + a  +I++av+g++r+Hi+D++i  Gl+Wp L++ L sR++gpp++RiT v+ p++g
  ONIVA11G23210.1 340 MFAAMTIMQAVQGKKRLHIVDYGIRCGLHWPDLFRRLGSREDGPPEVRITIVDIPQPG 397
                      ****************************************************999887 PP

2GRAS237.36.7e-736389492315
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lL++cA+a ++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+ +++ly+     ++ +++ +e l+++kl+  ++ + k++ 
  ONIVA11G23210.1 638 RLLLIQCAQATATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGRGKHLYQ-----NQMRMSLVEYLKVYKLYMAACCFKKVAL 726
                      568***************************************************9999994.....33446699******************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + a  +I++av+g++r+Hi+D++i  Gl+Wp Ll+ L sR++gpp++RiT v+  ++     +++ee g+ L++ A+e++vpf+f++++a ++e
  ONIVA11G23210.1 727 MFAAMTIMQAVQGKKRLHIVDYGIRCGLHWPDLLRRLGSREDGPPEVRITIVDILQPAfrPFQRIEEAGHCLSSCANEFRVPFRFQAVAAAKWE 820
                      *****************************************************99998999**************************9999*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++  e+L+++p+E+l+Vn   +   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf   l yysalf  l+a+ pr+s
  ONIVA11G23210.1 821 TVGAEDLHIEPDEVLVVNDLWSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGIINGSY-GASFLSRFRAVLLYYSALFGILDATTPRDS 913
                      ******************************98776669************************9.789*************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekW 315
                        r  +E+ llg+ + n++acega+ +er e++++W
  ONIVA11G23210.1 914 GLRLALEQNLLGPYALNAIACEGADLVERPEKYKQW 949
                      ************************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098523.148224394IPR005202Transcription factor GRAS
PfamPF035148.8E-37251397IPR005202Transcription factor GRAS
PROSITE profilePS5098549.307611949IPR005202Transcription factor GRAS
PfamPF035142.3E-70638949IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
MAIEEEDLNM ETAFPDEGWK SRILFAHSTW VAHDYMANPE DFFWEALLKE NEAPSPSPVF  60
SELPPTPLAN SDGSTDPSSL LDNQLLSYVS SMLMEDEMGS SAAVTNLQCV NRGSTEEANN  120
MLPGSEVVRA FLKGMEEASK LLPRNNSFRM LETVDQVSSH GHCRGGKKKN HDRDEQQLEE  180
ELGRSSKLAA MTNAGTEEAG ARELLDELML HSHETCIKDM EKLRIDMDNE ADKTIKKKGK  240
KGSSSKVVDL RMLLIQCAQA MATDNQQSAG ELLKKIKQHA LATGDAMQRV AHYFAKGLEA  300
RLAGSGKHLY QNHVRMSLVE YLKVYKLYMA ACCFKKVALM FAAMTIMQAV QGKKRLHIVD  360
YGIRCGLHWP DLFRRLGSRE DGPPEVRITI VDIPQPGQLP LNREKVMMVK NHYHKDFVIE  420
EDQYMANPED FFWEALLKKN EAPSPPPVFF DLPATPLSNS DGTDPSSLDN QLLSYVSRML  480
MEDEMGSSAA ITNLQCVNRG STEEANNMLP GSEVVRAFSK GMGEASKLLP RNNSFRTLET  540
VDQVSSDGHC RGRKNKNHDR DEQQLEEELG RSSKLAALTI AGTQEAGAHE LLDELMLHAH  600
ETCIKDMEKL RIDMDNEAEK KINKKDKKGS SSKVVDLRLL LIQCAQATAT DNQQSAGELL  660
KKIKQHALAT GDAMQRVAHY FAKGLEARLA GRGKHLYQNQ MRMSLVEYLK VYKLYMAACC  720
FKKVALMFAA MTIMQAVQGK KRLHIVDYGI RCGLHWPDLL RRLGSREDGP PEVRITIVDI  780
LQPAFRPFQR IEEAGHCLSS CANEFRVPFR FQAVAAAKWE TVGAEDLHIE PDEVLVVNDL  840
WSFSALMDES VFCDGPNPRD VALRNISKMQ PDVFIQGIIN GSYGASFLSR FRAVLLYYSA  900
LFGILDATTP RDSGLRLALE QNLLGPYALN AIACEGADLV ERPEKYKQW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-262549498314GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1659664LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616387.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0J5K40.0A0A0E0J5K4_ORYNI; Uncharacterized protein
STRINGLOC_Os11g47920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-89GRAS family protein