PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA10G19520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 194aa    MW: 21644 Da    PI: 6.9641
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA10G19520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR34.73.5e-11644240
              TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                     e+ +C+C +s+C ++YC+Cf ++ +Cs++C+C++C N +
  ONIVA10G19520.1  6 ERPKCSCVQSSCTQLYCRCFRSRYFCSDNCNCSGCYNIK 44
                     5679********************************965 PP

2TCR45.91.1e-14105143139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      k+ kgC+C+kskC k+YCeCf++ + C+ +CkC++C+N+
  ONIVA10G19520.1 105 KHAKGCSCRKSKCSKLYCECFKNSVGCTAKCKCQECSNS 143
                      589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-5546IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.8076145IPR005172CRC domain
PfamPF036381.1E-8942IPR005172CRC domain
SMARTSM011148.9E-12105146IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-11108143IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MANNQERPKC SCVQSSCTQL YCRCFRSRYF CSDNCNCSGC YNIKYYEDAI EEISDMIQMK  60
NPNAFDPRII VSVQDATAAD PQSSTSAISD PKNTSDAMPG NEQRKHAKGC SCRKSKCSKL  120
YCECFKNSVG CTAKCKCQEC SNSFGVKNSE SSNKPDPDDK SATDGLTHEE TTTENITLPG  180
ETWNSDPNKR PRYF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0985981e-130AC098598.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1007_H05, complete sequence.
GenBankAP0149611e-130AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126131e-130CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640260.11e-141protein tesmin/TSO1-like CXC 2 isoform X2
RefseqXP_025881429.11e-141protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A0E0A3G71e-140A0A0E0A3G7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IVV41e-140A0A0E0IVV4_ORYNI; Uncharacterized protein
TrEMBLB8AX811e-140B8AX81_ORYSI; Uncharacterized protein
STRINGOGLUM05G29120.11e-141(Oryza glumipatula)
STRINGONIVA10G19520.11e-141(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122672336
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.12e-21Tesmin/TSO1-like CXC domain-containing protein