PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA10G02660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family DBB
Protein Properties Length: 360aa    MW: 38295.6 Da    PI: 5.3443
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA10G02660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.35.4e-07447542
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      C+ ++  e++  C  ++  lC  C +e H        H++vpl
  ONIVA10G02660.1  4 QCNACGAAEARVLCCADEAALCTACDEEVHAAnklagkHQRVPL 47
                     7******99*********************66899999999986 PP

2zf-B_box27.75.4e-096395335
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                      +kC+ ++e    +fC +++ llC+dC +++H 
  ONIVA10G02660.1 63 VPKCDICQEASGFFFCLEDRALLCRDCDVSIHT 95
                     589*******9********************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.722147IPR000315B-box-type zinc finger
CDDcd000211.06E-8347No hitNo description
PfamPF006432.7E-5447IPR000315B-box-type zinc finger
SMARTSM003363.0E-9447IPR000315B-box-type zinc finger
SMARTSM003364.6E-1661108IPR000315B-box-type zinc finger
CDDcd000211.02E-964108No hitNo description
PfamPF006438.3E-76495IPR000315B-box-type zinc finger
PROSITE profilePS501198.61766108IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009658Biological Processchloroplast organization
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010099Biological Processregulation of photomorphogenesis
GO:0015995Biological Processchlorophyll biosynthetic process
GO:0016607Cellular Componentnuclear speck
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MKIQCNACGA AEARVLCCAD EAALCTACDE EVHAANKLAG KHQRVPLLSD GGAAPAAAAA  60
PAVPKCDICQ EASGFFFCLE DRALLCRDCD VSIHTVNSLV SVHQRFLLTG VQVGLDPADP  120
VPPVADKHVK SAGGSVDSAT KHLQRNPTDL SGENSASLPS QNVINGNYSR QSSATMAKTG  180
QVNWTMSNNT IRSIDPPPKY SSEESPALLL ASHTNTVAAY SNQISKDSDR IYNLPFTGGN  240
GSDSLHDWHV DEFFSNSEFG FAEHGSSKGD NAKPGSAGGS PQCRLAEGLF VEGLLGQVPD  300
NPWTVPEVPS PPTASGLYWQ NNLLCPSYDS TMFVPEISSL ENSQNNFTVS AGLKRRRRQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0018860.0AB001886.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:R2931.
GenBankAK1040830.0AK104083.1 Oryza sativa Japonica Group cDNA clone:001-029-D01, full insert sequence.
GenBankAK0722310.0AK072231.1 Oryza sativa Japonica Group cDNA clone:J023001E21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644333.10.0PREDICTED: B-box zinc finger protein 22
TrEMBLA0A0E0IPN80.0A0A0E0IPN8_ORYNI; Uncharacterized protein
STRINGORGLA06G0034600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17943382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.11e-55light-regulated zinc finger protein 1