PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA09G09540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 260aa    MW: 28192.1 Da    PI: 7.3029
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA09G09540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.63.1e-3678158383
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                       ++drhski T++g RdRR+Rls+++a+ fF+Lqd+LGfdk+skt++WLl+q+kpai+ l+ ++sss++++  +++ ssa+
  ONIVA09G09540.1  78 FRTDRHSKIRTAQGVRDRRMRLSLDVARDFFALQDRLGFDKASKTVDWLLTQSKPAIDRLAADPSSSSHRAAGDTRMSSAE 158
                      689************************************************************888886663333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136934.92279137IPR017887Transcription factor TCP subgroup
PfamPF036347.5E-3479158IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MQQQQLDQQQ QQQQQHQYDH FFSGHGQFNS ETLEAVLCRP PRGAAADPAV PAAAAAAAVL  60
TAARNGGGGH GRARKRPFRT DRHSKIRTAQ GVRDRRMRLS LDVARDFFAL QDRLGFDKAS  120
KTVDWLLTQS KPAIDRLAAD PSSSSHRAAG DTRMSSAERG GDHHMVAVGA AGSGKGDADK  180
ARGPRGGRSA PMELGCELGR LVPAPVLGEY YYELAEMMSN NTGGEGDDDG DYDDDGDFLD  240
DSGFLCHYRS KKKFSIKDIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0050930.0AP005093.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1294_G06.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankEU7024070.0EU702407.1 Oryza sativa Japonica Group putative TCP transcription factor (DP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611514.11e-130transcription factor TB1-like
TrEMBLA0A0E0IJF00.0A0A0E0IJF0_ORYNI; Uncharacterized protein
STRINGONIVA09G09540.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40523172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18550.28e-28TCP family protein