PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA09G06600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 366aa    MW: 38008 Da    PI: 5.4726
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA09G06600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.48.4e-37761751100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC++dC+la+yfpa+++++f n+h+lFG+s+++k+l+++p+e + dam++l++eA+ara+dPv Ga++v+ +l +q+e l+ael
  ONIVA09G06600.1  76 ACAACKYQRRKCNADCPLARYFPADEQRRFLNAHHLFGVSKIQKTLRDTPPELHADAMQALTFEANARASDPVGGAARVVVELCRQYEMLHAEL 169
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+++++
  ONIVA09G06600.1 170 AAVQHH 175
                      ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.7975176IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3376173IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MTASSSTTNS SSSVSTADTS SSNPPPQHAL HRQHIARSSA SSGGGGAAAP LPPRAPPRVG  60
VGGGGGGGGG VGQSQACAAC KYQRRKCNAD CPLARYFPAD EQRRFLNAHH LFGVSKIQKT  120
LRDTPPELHA DAMQALTFEA NARASDPVGG AARVVVELCR QYEMLHAELA AVQHHLKLCR  180
QQHAAAAAAA ANDQLVANVD PLADPAAEML FAGAVVPNQN DDAMVDAFYA DQQTAGDGDQ  240
EQYLVKDEAL AAQPPPQQPY EYLNYGTAGD EGSSHAWYTG NGGDADASPP MGLSDQLQQC  300
QIGAAPPFDV KPELPATMEH GGSVFVEQPE QKILPAAGSS SSAAAHCQLE LGCSSNAWKV  360
GTHVIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611163.10.0PREDICTED: LOB domain-containing protein 19, partial
TrEMBLA0A0E0IIC30.0A0A0E0IIC3_ORYNI; Uncharacterized protein
STRINGBGIOSGA030605-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP182931010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.12e-29LOB domain-containing protein 7