PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G23410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 198aa    MW: 21875.7 Da    PI: 5.2568
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G23410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.68.8e-38451441100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaC++lrr+Ca+dCvlap fpa++p+++a+vh++FGasnv +ll++lp  er +a++++++eA +r++dPvyG++g+i++lq++++ ++ el
  ONIVA08G23410.1  45 RCAACRYLRRRCADDCVLAPFFPASRPHRYACVHRVFGASNVARLLQSLPMAERGNAANTMAMEAYWRVQDPVYGCTGIINRLQEEIRAVQCEL 138
                      6********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+++++
  ONIVA08G23410.1 139 ARTQAH 144
                      *99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.19844145IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3745142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MIDSAVSSPN PAKIFGDPAP KISRTMQDPE EDDDDQQQQH PAARRCAACR YLRRRCADDC  60
VLAPFFPASR PHRYACVHRV FGASNVARLL QSLPMAERGN AANTMAMEAY WRVQDPVYGC  120
TGIINRLQEE IRAVQCELAR TQAHLAIAVA SSQQPPPPPP PPPLPSPPPP QQQQQQQEEQ  180
SPPPLLDPAD EFLNLDGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126161e-175CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649340.11e-105PREDICTED: LOB domain-containing protein 24
SwissprotP594688e-40LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0E0IEK31e-141A0A0E0IEK3_ORYNI; Uncharacterized protein
STRINGBGIOSGA029005-PA1e-137(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.18e-32LOB domain-containing protein 24