PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G00920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 220aa    MW: 24974.8 Da    PI: 7.9772
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G00920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.58.7e-241056248
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                     rien   rqvtf+kRr+g+lKKA ELS+LC+a++ +iifs +gkly+
  ONIVA08G00920.1 10 RIENPVHRQVTFCKRRAGLLKKARELSILCEADIGIIIFSAHGKLYD 56
                     8********************************************97 PP

2K-box211.4e-08881701786
            K-box  17 lqqelakLkkeienLqreqRhllGedL.............esLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                       +qe+  Lk+ei+ Lq+ +Rhl  +++             e ++++eL+ Le+ Le  + +iRs K+ +l++  e lq+k  e
  ONIVA08G00920.1  88 PKQEAMVLKQEINLLQKGLRHLTLDKIkthgryiygnranEHMTVEELNALERYLEIWMYNIRSAKEGMLKAANEILQEKIVE 170
                      456666666666666655555544444111111133333357************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.917161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-26176IPR002100Transcription factor, MADS-box
CDDcd002651.66E-38279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.33985187IPR002487Transcription factor, K-box
PfamPF014862.9E-986167IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSILCE ADIGIIIFSA HGKLYDLATT  60
GTMEELIERY KSASGEQANA CGDQRMDPKQ EAMVLKQEIN LLQKGLRHLT LDKIKTHGRY  120
IYGNRANEHM TVEELNALER YLEIWMYNIR SAKEGMLKAA NEILQEKIVE QNGLIDVGMM  180
VADQQNGHFS TVPLLEEITN PLTILSGYST CRGSEMGYSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-15170169MEF2C
5f28_B4e-15170169MEF2C
5f28_C4e-15170169MEF2C
5f28_D4e-15170169MEF2C
6byy_A5e-15174173MEF2 CHIMERA
6byy_B5e-15174173MEF2 CHIMERA
6byy_C5e-15174173MEF2 CHIMERA
6byy_D5e-15174173MEF2 CHIMERA
6bz1_A4e-15174173MEF2 CHIMERA
6bz1_B4e-15174173MEF2 CHIMERA
6bz1_C4e-15174173MEF2 CHIMERA
6bz1_D4e-15174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033261e-179AB003326.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:R3786.
GenBankAK0691221e-179AK069122.1 Oryza sativa Japonica Group cDNA clone:J023004P21, full insert sequence.
GenBankAY1155561e-179AY115556.1 Oryza sativa (indica cultivar-group) MADS-box protein FDRMADS3 mRNA, complete cds.
GenBankAY5519251e-179AY551925.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650791.11e-147MADS-box transcription factor 26
SwissprotA2YQK91e-148MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-148MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0E0I6I91e-162A0A0E0I6I9_ORYNI; Uncharacterized protein
STRINGONIVA08G00920.11e-163(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-48AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]