PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA05G18780.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 274aa    MW: 28561 Da    PI: 9.8676
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA05G18780.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.39.3e-15186238355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v+eLe+e  +L  e ee +++
  ONIVA05G18780.2 186 AMQRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQK 238
                      689***************************************99887765554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-10184253IPR004827Basic-leucine zipper domain
PfamPF001701.8E-12186237IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875186234IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-11188237No hitNo description
CDDcd147073.60E-17188234No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-13189236No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MASSRVMAAA AASSSSSPPP PPPAAAAAGG AADLARFRST SSGIGSMNMD DILRNIYGEA  60
APPPGAAGSA PAPPPAGEAA GAPVAEVAAR RTAEEVWKEI SSSGGLSAPG PAPAAGAAGR  120
SGGPEMTLED FLAREDDPRA TAVEGNMVVG FPNGTEGVGT AGGGRGGGGG GRGRKRTLMD  180
PADRAAMQRQ KRMIKNRESA ARSRERKQAY IAELEAQVAE LEEEHAQLLR EQEEKNQKRL  240
KEKWHVFMQI KEQAVAVVIR KKTQDLRRTN SMEW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170GGRGGGGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1206560.0AK120656.1 Oryza sativa Japonica Group cDNA clone:J013158B06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639395.11e-120bZIP transcription factor 12-like
SwissprotQ0JHF12e-61BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A0E0HF200.0A0A0E0HF20_ORYNI; Uncharacterized protein
STRINGONIVA05G18780.20.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.14e-12G-box binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]