PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G23030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LFY
Protein Properties Length: 390aa    MW: 42641.4 Da    PI: 8.4779
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G23030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY545.71.6e-16613791386
          FLO_LFY   1 mdpea.fsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmks 92 
                      mdp++ fsa+  f+wd  +    +pa + +    +++         a+  releel+ +yGvr++tva+i+elGft+stL+ m+++eldd+m++
  ONIVA04G23030.1   1 MDPNDaFSAAhPFRWDLGPP---APAPVPPPPPPPPP-----PPPPANVPRELEELVAGYGVRMSTVARISELGFTASTLLAMTERELDDMMAA 86 
                      777654776559****5422...22223222222222.....345567789******************************************* PP

          FLO_LFY  93 lseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekk 186
                      l+ +fr+dll+Ger+G++aa+raer rl++     +++    +++ +++d +sqe+lsee++     +agsgg+g  +++  +++ kk+ ++ +
  ONIVA04G23030.1  87 LAGLFRWDLLLGERFGLRAALRAERGRLMSLG--GRHH---GHQSGSTVDGASQEVLSEEHD-----MAGSGGMGDDDNGRRMVTGKKQAKKGS 170
                      *****************************965..5555...6788899***********976.....678888888888887777766666666 PP

          FLO_LFY 187 kaskk.kqkrkkkkelkseededeeeeededeeg........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiak 271
                       a+k  k++rkk ++l+ + +ede +  ded+ g        +g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq++ak
  ONIVA04G23030.1 171 AARKGkKARRKKVDDLRLDMQEDEMDCCDEDGGGgsestessAGGGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRLFLLQVQSMAK 264
                      555543667777777666644444443333333334455554888899********************************************** PP

          FLO_LFY 272 erGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprL 365
                       +G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeas+alrra+k+rgenvGawrqacy+plv+i+ar+g+didavf+ahprL
  ONIVA04G23030.1 265 LHGHKSPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASDALRRAYKARGENVGAWRQACYAPLVDISARHGFDIDAVFAAHPRL 358
                      ********************************************************************************************** PP

          FLO_LFY 366 siWYvPtkLrqLChlerskas 386
                      +iWYvPt+LrqLCh++rs+++
  ONIVA04G23030.1 359 AIWYVPTRLRQLCHQARSSHA 379
                      ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.1E-1921379IPR002910Floricaula/leafy protein
SuperFamilySSF1014472.62E-62837No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP APAPVPPPPP PPPPPPPPAN VPRELEELVA GYGVRMSTVA  60
RISELGFTAS TLLAMTEREL DDMMAALAGL FRWDLLLGER FGLRAALRAE RGRLMSLGGR  120
HHGHQSGSTV DGASQEVLSE EHDMAGSGGM GDDDNGRRMV TGKKQAKKGS AARKGKKARR  180
KKVDDLRLDM QEDEMDCCDE DGGGGSESTE SSAGGGGGER QREHPFVVTE PGEVARAKKN  240
GLDYLFHLYE QCRLFLLQVQ SMAKLHGHKS PTKVTNQVFR YAKKVGASYI NKPKMRHYVH  300
CYALHCLDEE ASDALRRAYK ARGENVGAWR QACYAPLVDI SARHGFDIDA VFAAHPRLAI  360
WYVPTRLRQL CHQARSSHAA AAAALPPPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A8e-992173852170PROTEIN LEAFY
2vy2_A8e-992173852170PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0056200.0AB005620.1 Oryza sativa mRNA for RFL gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635355.10.0probable transcription factor FL
SwissprotA2XX390.0FL_ORYSI; Probable transcription factor FL
TrEMBLA0A0E0H5F50.0A0A0E0H5F5_ORYNI; Uncharacterized protein
STRINGONIVA04G23030.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-97floral meristem identity control protein LEAFY (LFY)