PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G21910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 619aa    MW: 64918.2 Da    PI: 7.5717
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G21910.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS283.65.5e-872626192374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A a+++g++e a + L+ l+  a+++gd  qRl+a+++ AL++r+ +       + ++ +       e+ a  +l++++sP+++++ 
  ONIVA04G21910.1 262 RQLLSEAAAAIADGHNETAATHLTALKRAANSRGDVEQRLVAMMVAALSSRIGQ-------TASVPDI---CGGETRAGSQLLHDISPCFRLAL 345
                      689**************************************************9.......1111122...24455566789************ PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                       +aN aI++av  ++++H +Dfd+s + Q + L++ La+R+ +  sl++T+v +p+s  ++++ +t   L+k+Ae+ g++ +f++ v+ r  ++
  ONIVA04G21910.1 346 HAANVAIVDAVGDHRAIHLVDFDVSAP-QHADLIRCLAARRLPGTSLKVTAVTDPASPFTQSVTAT-LHLQKLAERAGIDYRFKM-VSCRAGEI 436
                      ************************987.99************************987666666555.57***************9.7999**** PP

             GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                      e ++L ++ gEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv +veqe++ n++++ +rf++a+ +y a+++sl+a++pres er+
  ONIVA04G21910.1 437 EASKLGCEAGEALAVNLAFALSHVPDESVSPANPRDEILRRVRALGPQVVALVEQELNSNTAPLTTRFTDACAHYGAILESLDATIPRESAERA 530
                      ********************************************************************************************** PP

             GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        E++ lg ++ n+va ega+r er+e ++kWr+r+++aGF+pv+l+  +a+q+ +    v+  g+ v+ e+g l lgW++r ++++SaWr
  ONIVA04G21910.1 531 RAEAA-LGGRAANAVAREGADRLERCEVFGKWRSRFGMAGFRPVALGPGIADQVLARQGPVA-AGFAVKAENGVLRLGWMGRVVTVASAWR 619
                      ****9.9999*******************************************977777777.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.155235600IPR005202Transcription factor GRAS
PfamPF035141.9E-84262619IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYLYGVGS AVQMPMQQRS DAAAAGGVLK RSLGDMERWQ QHQHQQRQIA  60
MQQQLYLRTV RQRTAAASAA VSPLTSADIA AVLGGPPSQP LVLSGSSMGG AFGSPSSTLS  120
SITTASRAVA MPLMQPQLQR QQQVTYMASS PQVQAFGTAR ALPPAPATSD LSILQELEKQ  180
LLGDDDEVEA AMSGTGSAVT GSEWEEQLNS ITAAPSPPLT AATTPNNNNN AVGMTRSPSN  240
SSTSTASSSA SCSPPTSATT SRQLLSEAAA AIADGHNETA ATHLTALKRA ANSRGDVEQR  300
LVAMMVAALS SRIGQTASVP DICGGETRAG SQLLHDISPC FRLALHAANV AIVDAVGDHR  360
AIHLVDFDVS APQHADLIRC LAARRLPGTS LKVTAVTDPA SPFTQSVTAT LHLQKLAERA  420
GIDYRFKMVS CRAGEIEASK LGCEAGEALA VNLAFALSHV PDESVSPANP RDEILRRVRA  480
LGPQVVALVE QELNSNTAPL TTRFTDACAH YGAILESLDA TIPRESAERA RAEAALGGRA  540
ANAVAREGAD RLERCEVFGK WRSRFGMAGF RPVALGPGIA DQVLARQGPV AAGFAVKAEN  600
GVLRLGWMGR VVTVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-342576191375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8312090.0CT831209.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA055J15, full insert sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066880.0AL606688.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0064M23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637100.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA2XWQ90.0A2XWQ9_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0H5150.0A0A0E0H515_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PD450.0A0A0E0PD45_ORYRU; Uncharacterized protein
TrEMBLI1PP580.0I1PP58_ORYGL; Uncharacterized protein
TrEMBLQ7X7C00.0Q7X7C0_ORYSJ;
STRINGBGIOSGA014504-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g49110.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0197700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-88SCARECROW-like 8