PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G19340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 968aa    MW: 106946 Da    PI: 8.5053
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G19340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.7e-08290382147
                      TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqky 47 
                      +++W+  E e+l++++kq   +                                              +W++Ia++   gR++ +c srw+++
  ONIVA04G19340.1 290 KQPWSDVEKEKLAKGIKQQYQEalilnsinkgsstgdfsavdmayaltntagnfevtpeslrsvlpliNWDKIAAMYLPGRSGAECESRWLNF 382
                      79****************99999***************************************************99888************97 PP

2Myb_DNA-binding29.41.8e-09390434246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v+q G+++W  Ia t+g++Rt+ qc  r+q 
  ONIVA04G19340.1 390 NAWTAREEKRLILTVQQQGMNNWINIAVTLGTHRTPFQCLVRYQR 434
                      68**************************************99995 PP

3Myb_DNA-binding43.47.9e-14444487348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       W +eEd++l  av+ +G++ W ++++ m  gRt++qc +rw+k l
  ONIVA04G19340.1 444 DWAEEEDLQLQAAVNTFGTN-WQLVSASMD-GRTGNQCSNRWRKTL 487
                      6*****************99.*********.************975 PP

4Myb_DNA-binding48.61.9e-15495540248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+ +Ed++l  avk++G+ +W++Ia+ ++ gRt  qc +rw+++l
  ONIVA04G19340.1 495 GRWSLDEDKRLMVAVKLFGSSSWNKIAQFIP-GRTQSQCNERWRNVL 540
                      8******************************.************986 PP

5Myb_DNA-binding31.44.3e-10547591247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                      g W +eEd +l+  v ++G+  W++Ia ++++ +Rt+++c  rw+k+
  ONIVA04G19340.1 547 GEWRPEEDSILLASVDEFGPC-WSKIAgAKIP-HRTDNMCLRRWRKL 591
                      68*****************88.****945777.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.377285383IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.9E-7286308IPR009057Homeodomain-like
SMARTSM007179.8E-6289385IPR001005SANT/Myb domain
CDDcd001670.0011354382No hitNo description
Gene3DG3DSA:1.10.10.603.9E-7355369IPR009057Homeodomain-like
SuperFamilySSF466897.26E-5358397IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-7370403IPR009057Homeodomain-like
PROSITE profilePS5129410.749384440IPR017930Myb domain
SuperFamilySSF466891.65E-21388483IPR009057Homeodomain-like
SMARTSM007176.6E-4388438IPR001005SANT/Myb domain
PfamPF002497.0E-6390434IPR001005SANT/Myb domain
CDDcd001671.29E-4391436No hitNo description
Gene3DG3DSA:1.10.10.602.3E-10404447IPR009057Homeodomain-like
SMARTSM007171.2E-11441489IPR001005SANT/Myb domain
PfamPF002493.6E-12444486IPR001005SANT/Myb domain
PROSITE profilePS500909.721445487IPR017877Myb-like domain
CDDcd001672.44E-9445487No hitNo description
Gene3DG3DSA:1.10.10.602.6E-14448490IPR009057Homeodomain-like
PROSITE profilePS5129418.909488544IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-18491542IPR009057Homeodomain-like
SMARTSM007171.2E-11493542IPR001005SANT/Myb domain
SuperFamilySSF466892.5E-25493588IPR009057Homeodomain-like
PfamPF002491.3E-14495540IPR001005SANT/Myb domain
CDDcd001675.99E-11496540No hitNo description
Gene3DG3DSA:1.10.10.603.8E-15543596IPR009057Homeodomain-like
SMARTSM007171.9E-8545594IPR001005SANT/Myb domain
PfamPF002493.3E-8547591IPR001005SANT/Myb domain
PROSITE profilePS5129413.267547596IPR017930Myb domain
CDDcd001676.29E-9548591No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 968 aa     Download sequence    Send to blast
MDFYSDDSDP DIDEDLQRDL DALRQSCILS GNDPDAAVAQ VSACLAAPPA AAAGAEVNGL  60
SDDDDEEEDE DLALVRSIRE NLLLNKASPS SPLPRPICAW PPSDSEDDED DLETLRAIQR  120
RFSHYHSGTS SGSEMNTKTE ASKEGSGNFF GNELDEEFDA EKHNKEATTR TGFPKAALLL  180
VDALKKNRAC QKFIRRKMIT IEAKIEENKD LRDRVKCLLD YQLSCRKAFG KILCQKEDPR  240
VRLISSRKPC AQSTKNKDKK TPALFLGPAD NPHVSKYKMV LKQLPMSLQK QPWSDVEKEK  300
LAKGIKQQYQ EALILNSINK GSSTGDFSAV DMAYALTNTA GNFEVTPESL RSVLPLINWD  360
KIAAMYLPGR SGAECESRWL NFDDPLINHN AWTAREEKRL ILTVQQQGMN NWINIAVTLG  420
THRTPFQCLV RYQRSLNHCI LNKDWAEEED LQLQAAVNTF GTNWQLVSAS MDGRTGNQCS  480
NRWRKTLNPE RSRVGRWSLD EDKRLMVAVK LFGSSSWNKI AQFIPGRTQS QCNERWRNVL  540
DPDIDLGEWR PEEDSILLAS VDEFGPCWSK IAGAKIPHRT DNMCLRRWRK LCQDKLPSVK  600
AAQQIKKSIL QCNFVDRETE RPAIGPSDLM PLVRSKVDGS DENTVSANVR KPRKRSRIPC  660
EDNVLPGDTS NSSPSMNLPL SESIDAEAAV NTTTANSKKK PSRSRSKKQT DENLAVCDVN  720
NSSNCSSGAR KRKRSITDKN QVVQKKMKGS ISGDNEAVVE TVGTISADNE VATKRKTGST  780
SVGEEGTTKK TTRGSLSGKG EVNKRMRGSI SGVQKGATKQ RMRGSVSTDN HGAVMKSKRA  840
PSRKSAEENS KADSMANAAF GSDLPTVASE DRDADNGNVK NGRLKSMPRP KQINMTEGSA  900
DKFSTSTRLA DCMSFGRING SSRVARHLCV SVKPLSNMIQ SNGPSDVSAK DPTSAETDPT  960
SVENSNTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-263615968159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-263615968159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647432.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647433.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647435.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647436.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647437.10.0PREDICTED: myb-like protein L isoform X1
TrEMBLA0A0E0H4010.0A0A0E0H401_ORYNI; Uncharacterized protein
STRINGLOC_Os07g04700.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA024846-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-148myb domain protein 4r1