PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G18450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family DBB
Protein Properties Length: 329aa    MW: 35044 Da    PI: 5.4616
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G18450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.11.3e-0678118438
         zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 
                        C+ +  + ++ fC  ++  lC+ C    H+       H+
  ONIVA04G18450.1  78 VQCDVCAAEAASVFCCADEAALCDACDRRVHSAnklagkHR 118
                      68**************************9996566777776 PP

2zf-B_box25.72.3e-08134167235
         zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35 
                      +++ C+ ++ek+  lfC++++  lC++C ++ H 
  ONIVA04G18450.1 134 KPPLCDICQEKRGFLFCKEDRAILCRECDVAVHT 167
                      6899***************************994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.02575122IPR000315B-box-type zinc finger
SMARTSM003361.6E-1375122IPR000315B-box-type zinc finger
CDDcd000211.28E-778122No hitNo description
PfamPF006432.2E-578119IPR000315B-box-type zinc finger
SMARTSM003363.4E-14133180IPR000315B-box-type zinc finger
PROSITE profilePS5011910.168133180IPR000315B-box-type zinc finger
PfamPF006431.1E-6134167IPR000315B-box-type zinc finger
CDDcd000213.13E-9136180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVALPVLSSG DGPSGDTKSD LVTWIGGDCS KEGLWQDSDE LNGDASGNQG GRKARSRRRA  60
RWRCQKWLGS NVLSRAKVQC DVCAAEAASV FCCADEAALC DACDRRVHSA NKLAGKHRRF  120
SLLQPLASSS SAQKPPLCDI CQEKRGFLFC KEDRAILCRE CDVAVHTTSE LTRRHGRFLL  180
TGVRLSSAPM DSPAPSEEEE EEAGEDYSCS PSSVAGTAAG SASDGSSISE YLTKTLPGWH  240
VEDFLVDEAT AAAAAASSSS DGLFQGGLLA QIGGVPDGYA AWAGREQLHS GVAVAADERA  300
SRERWVPQMN AEWGAGSKRP RASPPCLYW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8301690.0CT830169.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA102E21, full insert sequence.
GenBankAK0613330.0AK061333.1 Oryza sativa Japonica Group cDNA clone:006-303-A11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634023.11e-173PREDICTED: B-box zinc finger protein 20 isoform X2
SwissprotQ9LQZ76e-55BBX21_ARATH; B-box zinc finger protein 21
TrEMBLA0A0E0H3P20.0A0A0E0H3P2_ORYNI; Uncharacterized protein
STRINGBGIOSGA016847-PA1e-172(Oryza sativa Indica Group)
STRINGLOC_Os04g45690.11e-172(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23923679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.11e-27salt tolerance homolog2