PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G02150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 211aa    MW: 23790.8 Da    PI: 8.6756
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G02150.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR40.26.9e-136199240
              TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                     ++++C+C ks+C+k+YC Cf+a  +Cs++C+C++CkN+e
  ONIVA04G02150.1 61 QHRSCRCVKSNCVKLYCLCFSAYGYCSQNCRCTNCKNRE 99
                     6789*********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.1E-960101IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163417.14561161IPR005172CRC domain
PfamPF036385.4E-106399IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGQASISSSS SSPAPSTVAA FSPLRPPSAA SHTNQGMRAS LPLALLLLLR LISARSMSND  60
QHRSCRCVKS NCVKLYCLCF SAYGYCSQNC RCTNCKNREY YEDFVEERVD MIKMKNPRAF  120
DPKIVRVQDA SEIEPQSSNA VLHEVRCTSK CQCIDCGNGP RTKCEYTRLL FLFPCLMTSK  180
CVINCFGIAW KHRILILFFT HVIFFVLNIF I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7315891e-114AL731589.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0039G19, complete sequence.
GenBankAP0149601e-114AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126121e-114CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0GXQ41e-154A0A0E0GXQ4_ORYNI; Uncharacterized protein
STRINGONIVA04G02150.11e-155(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122672336
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.12e-15Tesmin/TSO1-like CXC domain-containing protein