PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G32760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GeBP
Protein Properties Length: 372aa    MW: 39855.6 Da    PI: 7.0732
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G32760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57387.51.7e-2784178297
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                      +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+ + +++sql+eK+rrLK+Kf+++++++++g +p+  ++hd+++++l++++
  ONIVA03G32760.1  84 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPSPYTRSQLSEKLRRLKNKFRGMSTRVARGLDPARLAPHDRDVLHLCSRL 176
                      79*******************.556878888*************************************************************** PP

           DUF573  96 Wg 97 
                      W+
  ONIVA03G32760.1 177 WD 178
                      *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2485178IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MASDQTLPVP VSVELPPAAP NPPDPTAPLL PHADDPSAPP AAARKLPVKR RSPPPRPSSP  60
SSSDPASSDP AAKQQPQQPP PPFKFQRIWS ESDELRFLQG LLGCGAQGLV FPRDLNVFYD  120
RFSESMPSPY TRSQLSEKLR RLKNKFRGMS TRVARGLDPA RLAPHDRDVL HLCSRLWDPA  180
NAATSPFAAA GDASSGNKRR RAAPRAGPLM PPDPSGDSNS HDYNGGISAG TPGAFGDGHG  240
GEEMMYLEQE SGHFGYHGDV AIAADGSLDG IVKVQPETLP ALPSIGDIAV HSENGNGKAV  300
VPRSNEHHMA NAVLDIFEEC LREVKANGIT YGANVNGGTE LARRWRAQRI DELDVLSRRL  360
RLLVEDAAAA GR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0871810.0AC087181.9 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone OSJNBa0018H01 map R1538, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCT8338990.0CT833899.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN056B15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628567.10.0probable transcription factor At5g28040
TrEMBLA0A0E0GSK80.0A0A0E0GSK8_ORYNI; Uncharacterized protein
STRINGONIVA03G32760.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.22e-09DNA-binding storekeeper protein-related transcriptional regulator