PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G27260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 1601aa    MW: 181457 Da    PI: 10.0042
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G27260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.43.4e-15361171198
                      HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +++ +++p kf++++gg+   s t++l++++g  + v++  +k+++++vl+ GW+ Fv+a++++e+D+++F+++++s+f   v +f+
  ONIVA03G27260.1  36 DSRRSMIMPCKFVNHFGGD--FSGTIKLQSPNGILYAVEV--TKCKNKTVLRCGWEAFVDAHHIEENDSLLFRRVENSRF--EVLIFD 117
                      45566999*****888999..7779***************..*******************************8888888..888887 PP

2B339.51e-122273081898
                      --HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS..SEE..EEEEE- CS
               B3  18 lpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr..sefelvvkvfr 98 
                      ++  +ae h   +++s+t+tl+   ++++W  ++  rk  ++ +l++ W eFvk+n+++e D++vF  +++  ++f+++v+++r
  ONIVA03G27260.1 227 ISFCYAEVHF--PHKSVTVTLQRpCKSKKWHPRFYKRKDARMNILRGSWVEFVKDNRVQEQDICVFVPTKDarRNFTFTVHLLR 308
                      3333344443..56899******5677*******77888889*************************66442577878887776 PP

3B345.41.4e-144194961090
                      HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
               B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      + ++++l l  +fa++  ++ ++  + ++ +++g++W   +++r + +r ++ +GW +Fv++n+L++gD+++F+++ +++ 
  ONIVA03G27260.1 419 SASRCQLELGARFAAAVHLPDRR--QTVVLQRRGERWATVMQIRSGTRRLLI-SGWHRFVRDNRLRVGDICLFEFKTHERW 496
                      345599********999888655..3666778*********88888877655.5********************8755444 PP

4B344.33.2e-147498281297
                      HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + + +++p +f++++ggk   + t++le+++g  + v++  + + ++++l+ GW+ Fv+a+++keg++++F+++++s+    v ++
  ONIVA03G27260.1 749 SMHSMIMPDRFVSHFGGK--IPGTIKLESPNGILYVVEV--TECMNKTLLQCGWEAFVDAHNIKEGESLLFRHIENSRY--EVLIL 828
                      456799******888888..5669***************..*******************************9986655..66665 PP

5B339.51e-1295810401698
                       EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE- CS
               B3   16 lvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfr 98  
                       lv++ ++a+ h   ++e+ t+tl+ +s  ++W  ++  r  ++ ++l++ W++Fv++n L+e D+++F  ++  ++f ++v++++
  ONIVA03G27260.1  958 LVISSRYASVHF--PRETATITLQRPSKrKKWYPRFYKRIDKSDHMLRGQWQNFVHDNCLQEEDICLFVPTKGgRNFAFTVHLLQ 1040
                       799999999997..456779*****66659******66777777*************************8766589988888876 PP

6B347.33.6e-15115612391698
                       EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE.....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3   16 lvlpkkfaeeh.ggkkeesktltledesgrsWevkliy...rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98  
                       l l+ ++a+++   +k +++tl+l + +g  W+++l +     k++r +lt+GW++F+++n+L++gDf++F+l+++++ ++ v++++
  ONIVA03G27260.1 1156 LELSSRYAASYlP-DK-NHQTLVL-QCKGMIWQINLVVrrrYTKGKRWFLTAGWRKFAHDNRLRVGDFCLFELKKKKKLTMEVHIIS 1239
                       6788899999952.33.3346665.569*******97754433334478************************999*******9986 PP

7B353.44.8e-17127913601097
                       HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3   10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97  
                       + + + +++p +f++++ggk   + t++le+++g  + v++  + + +++vl+ GW+ Fv+a+++k+gD+++F+++++s+f   v+++
  ONIVA03G27260.1 1279 TDSMHSMIIPDRFVNHFGGK--IPGTIKLESPNGILYVVEV--TECMNKTVLQCGWEAFVDAHHIKVGDSLLFRHIENSCF--EVMIL 1360
                       4455679*******888888..5669***************..**************************************..66665 PP

8B341.62.2e-13151215951496
                       T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE....EEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEE CS
               B3   14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr....yvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkv 96  
                       ++l l  ++a++  ++ ++  + ++ ++ g++W+  +  + ksgr     +l +GW++Fv++n+L++gD+++++l+++ s+ +++v+ 
  ONIVA03G27260.1 1512 CQLELGARYAAAVHLPDRR--QAVVLQRMGQRWDTVM--QTKSGRcttrRFLINGWSRFVRDNRLCVGDICLLELKKHeSKLTMTVHT 1595
                       6677777788777777555..5889999*********..555555224445557*********************9877888888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.18E-2222121IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-1924120IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.35126119IPR003340B3 DNA binding domain
CDDcd100173.83E-1928117No hitNo description
SMARTSM010193.7E-1029119IPR003340B3 DNA binding domain
PfamPF023628.1E-1437117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-18201308IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-18202308IPR015300DNA-binding pseudobarrel domain
CDDcd100171.15E-17209308No hitNo description
SMARTSM010190.0022209310IPR003340B3 DNA binding domain
PROSITE profilePS5086310.701210310IPR003340B3 DNA binding domain
PfamPF023626.5E-11225308IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-19399499IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-17400495IPR015300DNA-binding pseudobarrel domain
CDDcd100171.59E-15405507No hitNo description
PROSITE profilePS5086311.998410504IPR003340B3 DNA binding domain
SMARTSM010196.0E-4411508IPR003340B3 DNA binding domain
PfamPF023623.1E-12420497IPR003340B3 DNA binding domain
SuperFamilySSF1019361.51E-19735833IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.139738831IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-16739832IPR015300DNA-binding pseudobarrel domain
CDDcd100179.84E-16739829No hitNo description
SMARTSM010191.5E-7741831IPR003340B3 DNA binding domain
PfamPF023621.9E-12749827IPR003340B3 DNA binding domain
SuperFamilySSF1019361.55E-179351040IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-179351041IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.00119421042IPR003340B3 DNA binding domain
CDDcd100172.29E-179421037No hitNo description
PROSITE profilePS5086310.2929431042IPR003340B3 DNA binding domain
PfamPF023626.3E-119581040IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-1711311238IPR015300DNA-binding pseudobarrel domain
CDDcd100173.78E-1411351239No hitNo description
PROSITE profilePS5086311.91411411241IPR003340B3 DNA binding domain
SMARTSM010191.6E-911411241IPR003340B3 DNA binding domain
SuperFamilySSF1019365.23E-1611521242IPR015300DNA-binding pseudobarrel domain
PfamPF023621.1E-1211561239IPR003340B3 DNA binding domain
SuperFamilySSF1019369.61E-2312671365IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-1912701365IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.60512701363IPR003340B3 DNA binding domain
CDDcd100171.71E-1812721361No hitNo description
SMARTSM010191.0E-1112731363IPR003340B3 DNA binding domain
PfamPF023621.5E-1512791360IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.9E-1614881594IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.54E-1514891594IPR015300DNA-binding pseudobarrel domain
CDDcd100173.53E-1214941594No hitNo description
SMARTSM010190.01315041600IPR003340B3 DNA binding domain
PfamPF023627.2E-1115121596IPR003340B3 DNA binding domain
PROSITE profilePS508639.96815301597IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1601 aa     Download sequence    Send to blast
MAGSGSCMKK SCVCCQKYLE HLDGKMNCFV RRMTADSRRS MIMPCKFVNH FGGDFSGTIK  60
LQSPNGILYA VEVTKCKNKT VLRCGWEAFV DAHHIEENDS LLFRRVENSR FEVLIFDSDD  120
CEKNHQRVKD LPEIKREASA IVEKQQTWHL LLRIQAREDS PSEHESVESG DLETSQEPYV  180
LSRRSYLSEF QKEKVDALIQ EIQPETTAFV AIMRKSNVQL PTPFLVISFC YAEVHFPHKS  240
VTVTLQRPCK SKKWHPRFYK RKDARMNILR GSWVEFVKDN RVQEQDICVF VPTKDARRNF  300
TFTVHLLRVA AAYSRGGTGV DRAGSSLGRT DVKSASEISI KEEPIDQEEN VSSRNRYGVS  360
DESEEDEDSE GPAHPPYIVP CKSRLSRLQK KIVEEKVRSI QSKFPVYVAI MKKSNVERSA  420
SRCQLELGAR FAAAVHLPDR RQTVVLQRRG ERWATVMQIR SGTRRLLISG WHRFVRDNRL  480
RVGDICLFEF KTHERWRLTM AVHAIFREHS RVALPRGGSG GDDPAAPLPH PYPLLRSASP  540
SPERPPAKPR GHKDGSGGVL LVSSRSGGLG SRPEWRRRCL PDPRRSGRIW RDGLAARTGD  600
GGGRGELRGV VLWVMAAGMA TVLGWRWWRP RIRRWRTRIR RRRTRIRRRR GGQRWPEHAS  660
TPRLPLASSG APLDIGRRWW RGRRPDLAPC PDPARPRVGT GWLESGRRAG GVNIAGNTHR  720
KKSCACCKEY LEHLGGKMRC FLRRMAADSM HSMIMPDRFV SHFGGKIPGT IKLESPNGIL  780
YVVEVTECMN KTLLQCGWEA FVDAHNIKEG ESLLFRHIEN SRYEVLILDS DDCEKVFSCA  840
GIRNGSCVQD KTVDPVDSSG SSSNDTTQSS RSRNTENLTA MCSSSEKSGE DSPSGYEFHE  900
SVEPQTPSGS DYVLSRRTYL SEAQKERVVA HIQDIQPEIT VFVAVMKKCN LQSPAPYLVI  960
SSRYASVHFP RETATITLQR PSKRKKWYPR FYKRIDKSDH MLRGQWQNFV HDNCLQEEDI  1020
CLFVPTKGGR NFAFTVHLLQ AEATHSRDGT DVHKIGSSQN KRNSKMASQV HIKEAPGGDV  1080
SSESNKHGVS HESLESEDSD GPSEPPYISS MRRRLSQLQK KTVEEKVRAI QSEIPICVAT  1140
ISKLAGSGGK GKFRGLELSS RYAASYLPDK NHQTLVLQCK GMIWQINLVV RRRYTKGKRW  1200
FLTAGWRKFA HDNRLRVGDF CLFELKKKKK LTMEVHIISN LQLHMAGGGS RMKKSCACCK  1260
RYLEHLGGKM SCFLIRMTTD SMHSMIIPDR FVNHFGGKIP GTIKLESPNG ILYVVEVTEC  1320
MNKTVLQCGW EAFVDAHHIK VGDSLLFRHI ENSCFEVMIL DSDGCERVFS CAGIKTSSCV  1380
HDKTVDPVDT SGRSSDDTAQ PSRSERFVRC QRDTSNDRRN TASLTVVSSS SEESENVSLK  1440
SNRNGVSDES QESEDSEGPA GPPYILSWKS KRRLSSLQKK IIKEKVRSIQ SEVPIYVAIM  1500
NKSNIGLISS PCQLELGARY AAAVHLPDRR QAVVLQRMGQ RWDTVMQTKS GRCTTRRFLI  1560
NGWSRFVRDN RLCVGDICLL ELKKHESKLT MTVHTIFSQQ S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1637644RIRRRRTR
212241230LKKKKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1193990.0AK119399.1 Oryza sativa Japonica Group cDNA clone:001-132-D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629380.10.0B3 domain-containing protein Os03g0619800
RefseqXP_015629381.10.0B3 domain-containing protein Os03g0619800
SwissprotQ6AV210.0Y3982_ORYSJ; B3 domain-containing protein Os03g0619800
TrEMBLA0A0E0GQK20.0A0A0E0GQK2_ORYNI; Uncharacterized protein
STRINGONIVA03G27260.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-18B3 family protein