PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G31120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 618aa    MW: 64196.4 Da    PI: 9.1169
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G31120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.97.5e-932546182374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A av++g++++a +lL+ l+  a+p+gd+ qRl+a+++ AL++r+           p+++ ++  s e+ aa +l+++vsP++ ++ 
  ONIVA02G31120.1 254 RQLLSEAAAAVADGNHTAAASLLSALKLSANPRGDAEQRLVAMMVAALSSRVGT--------GPSQHLADLYSGEHRAACQLLQDVSPCFGLAL 339
                      689*************************************************98........5666666666899999**************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakr 185
                        aN aIl+av+g++++H +Dfd+s  +Q +aL++aLa+R+ ++ sl++T+v++p+s      +++l +t erL+k+A++ g++f+f++ v+ r
  ONIVA02G31120.1 340 HGANLAILDAVAGHRAIHFVDFDVSA-AQHVALIKALADRRVPATSLKVTVVADPTSPftpaMTQSLAATCERLKKLAQQAGIDFRFRA-VSCR 431
                      ************************85.8**************************9988899999*************************.7899 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                        ++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l P+vv++veqe+++n+++ ++rf++a  +y a+++sl+a+l+r+s
  ONIVA02G31120.1 432 APEIEASKLGCEPGEALAVNLAFTLSRVPDESVSPANPRDELLRRVRALGPRVVTLVEQELNTNTAPMAARFSDASAHYGAVLESLDATLGRDS 525
                      ********************************************************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       +r+  E++ l+ ++ n+v  eg +r+er+e ++kWr+r+++aGF++v+++e++   +++ l       + v+ ++g l  gW++r ++++SaW
  ONIVA02G31120.1 526 ADRTRAEAA-LASKVANAVGREGPDRVERCEVFGKWRARFGMAGFRAVAIGEDIGGRVRARLGPAL-PAFDVKLDNGRLGVGWMGRVVTVASAW 617
                      ********9.9***************************************************9998.66************************* PP

             GRAS 374 r 374
                      r
  ONIVA02G31120.1 618 R 618
                      8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.082227599IPR005202Transcription factor GRAS
PfamPF035142.6E-90254618IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MDPAGAPWCD PRRGYGGYGV GSAALQAAAR QQSQQPRSDG AGGAGVTGGV LKRSLGEMER  60
WQQQRQVAAQ QAMYLRSVRQ RMDIGAVLGG AASSPAYGIS GLSSGFGGIS QQQPSSTMSS  120
LTTASRTVMS GMQQQRRMMA VPTAQNQAVA RAPAARPATA TELVLLQELE KQLLGDDEEA  180
DAAGSGCGSG ITSSDWGDTI QRLNSVTAAS SPSLPLPTAV NSTALLARSP TNSSSSTASS  240
SASSSPPISA ASSRQLLSEA AAAVADGNHT AAASLLSALK LSANPRGDAE QRLVAMMVAA  300
LSSRVGTGPS QHLADLYSGE HRAACQLLQD VSPCFGLALH GANLAILDAV AGHRAIHFVD  360
FDVSAAQHVA LIKALADRRV PATSLKVTVV ADPTSPFTPA MTQSLAATCE RLKKLAQQAG  420
IDFRFRAVSC RAPEIEASKL GCEPGEALAV NLAFTLSRVP DESVSPANPR DELLRRVRAL  480
GPRVVTLVEQ ELNTNTAPMA ARFSDASAHY GAVLESLDAT LGRDSADRTR AEAALASKVA  540
NAVGREGPDR VERCEVFGKW RARFGMAGFR AVAIGEDIGG RVRARLGPAL PAFDVKLDNG  600
RLGVGWMGRV VTVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-372496181375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0GBE80.0A0A0E0GBE8_ORYNI; Uncharacterized protein
TrEMBLA2X8C40.0A2X8C4_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA005839-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-94SCARECROW-like 8