PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G26290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family DBB
Protein Properties Length: 256aa    MW: 27393.6 Da    PI: 5.1167
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G26290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.54.9e-07446541
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                      C+ +e+  +   C  ++  lC+ C +e H        H++ p
  ONIVA02G26290.1  4 QCDACESAAAAVVCCADEAALCAACDVEVHAAnklagkHQRLP 46
                     7*******9*********************6678888898877 PP

2zf-B_box279.1e-095485334
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                      ++C+ ++ek + +fC +++ l+C+dC + +H
  ONIVA02G26290.1 54 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 85
                     689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.025147IPR000315B-box-type zinc finger
PfamPF006432.4E-5447IPR000315B-box-type zinc finger
SMARTSM003369.5E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501198.9025299IPR000315B-box-type zinc finger
SMARTSM003364.6E-145299IPR000315B-box-type zinc finger
PfamPF006431.7E-65495IPR000315B-box-type zinc finger
CDDcd000212.75E-75585No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010100Biological Processnegative regulation of photomorphogenesis
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MKIQCDACES AAAAVVCCAD EAALCAACDV EVHAANKLAG KHQRLPLEAL SARLPRCDVC  60
QEKAAFIFCV EDRALFCRDC DEPIHVPGTL SGNHQRYLAT GIRVGFASAS PCDGGSDAHD  120
SDHHAPPMGS SEHHHHHQQP APTVAVDTPS PQFLPQGWAL QKESSPPLGF QELEWFADID  180
LFHNQAPKGG AAAGRTTAEV PELFASQAAN DVAYYRPPTR TAAAAFTAAT GFRQSKKGRV  240
ELPDDEEDYL IVPDLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8588050.0HQ858805.1 Oryza sativa Japonica Group isolate UT1183 ORPHAN transcription factor mRNA, partial cds.
GenBankCU4065590.0CU406559.1 Oryza rufipogon (W1943) cDNA clone: ORW1943S101P19, full insert sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0064380.0AP006438.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0030C08.
GenBankAP0041110.0AP004111.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1058_F07.
GenBankAB0018850.0AB001885.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:R1577.
GenBankAK1042930.0AK104293.1 Oryza sativa Japonica Group cDNA clone:001-007-G06, full insert sequence.
GenBankAK0610440.0AK061044.1 Oryza sativa Japonica Group cDNA clone:006-205-E01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626533.11e-160PREDICTED: B-box zinc finger protein 25
TrEMBLA2X7020.0A2X702_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0G9M20.0A0A0E0G9M2_ORYNI; Uncharacterized protein
STRINGBGIOSGA008589-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32023368
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31380.14e-42salt tolerance homologue