PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G43200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 265aa    MW: 28020 Da    PI: 6.8273
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G43200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42.1e-15183235355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN ++ ke ee  ++
  ONIVA01G43200.1 183 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAKMFKEQEEQHQK 235
                      689*************************************9998877655444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-8181245IPR004827Basic-leucine zipper domain
PfamPF001703.4E-14183241IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657183247IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.63E-11185234No hitNo description
CDDcd147073.71E-20185235No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-13186244No hitNo description
PROSITE patternPS000360188203IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MASRVMASSS PSHTASDLAR FAAVRGGGGS AGLGSMNVEE ILRGIYADMP TPALPLVGGD  60
RPMSPLPAPD VAAAPRTAEE VWKEITGAGV AAAAGGVVPP AAAAAAAPAV VAGAGAGTGA  120
EMTLEDFLAR EGAVKEDEAV VTDPSAAKEQ VVMGFLNGAE VTGGVTGGRS RKRHLMDPMD  180
RAAMQRQKRM IKNRESAARS RERKQAYIAE LESLVTQLEE ENAKMFKEQE EQHQKRLKEL  240
KEMVVPVIIM KTSARDLRRT NSMEW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ9042380.0GQ904238.1 Oryza sativa Japonica Group ABA responsive element binding factor 1 mRNA, complete cds.
GenBankAK0679190.0AK067919.1 Oryza sativa Japonica Group cDNA clone:J013123H12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612904.10.0PREDICTED: G-box-binding factor 4
SwissprotP427771e-29GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A0E0FW600.0A0A0E0FW60_ORYNI; Uncharacterized protein
STRINGLOC_Os01g64730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-32bZIP family protein