PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G14030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 218aa    MW: 23849.2 Da    PI: 9.5575
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G14030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.87.7e-33109165158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy++Il+RRq+Rak+e+ekkl  k+rkpylheSRh+hAl+R+Rg gGrF
  OMERI12G14030.1 109 EEPVYVNAKQYNAILRRRQSRAKAESEKKL-VKGRKPYLHESRHQHALKRARGAGGRF 165
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.7E-35107168IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.332108168IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.3E-27110165IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23111133IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860113133IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23142165IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MTSVVHDVSG NHGADERQKQ QRQGEPEDQQ EASVTSTDSH TMVATPSTDY ATPYAHHDMA  60
HAMQGQIAYA NIDPYYGSLY AAYGGQPMMH PPLVGMHPAG LPLPTDAIEE PVYVNAKQYN  120
AILRRRQSRA KAESEKKLVK GRKPYLHESR HQHALKRARG AGGRFLNSKS DDKEEHSDSS  180
SRDKQDGVAP RDSGQPSTSP SSKGASSAKQ NKKSKTSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-22108172165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880280.0AB288028.1 Oryza sativa Japonica Group OsHAP2B mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0651630.0AK065163.1 Oryza sativa Japonica Group cDNA clone:J013002C07, full insert sequence.
GenBankHQ8396730.0HQ839673.1 Oryza sativa Japonica Group NF-Y transcription factor 22 (NF-Y22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618404.11e-160nuclear transcription factor Y subunit A-7 isoform X1
TrEMBLA0A0E0FEF51e-159A0A0E0FEF5_9ORYZ; Uncharacterized protein
TrEMBLQ2QM941e-159Q2QM94_ORYSJ; CCAAT-box transcription factor complex WHAP5, putative, expressed
STRINGOMERI12G14080.11e-160(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65553853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.26e-44nuclear factor Y, subunit A7