PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G12170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 349aa    MW: 37315.3 Da    PI: 8.8403
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G12170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.51.3e-2285129246
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                      pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  OMERI12G12170.1  85 PRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHM 129
                      9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-1983129IPR009057Homeodomain-like
SuperFamilySSF466891.74E-883128IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-1485128IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MSTTTSSSSD EAATAAMAPD LSLHISPPSP RLELGLADDT AVVAAKTTTD DERRRRHHQP  60
IQTAHGFKKS SGGGGGGGKR SARAPRMRWT TALHAHFVHA VELLGGHERA TPKSVLELMN  120
VKDLTLAHMY RTVKGTDRSC VAGHGQASRE MSFLMRRGLV AEVDSFDGFN NNNNNMVNTT  180
SNNTTSSPSH QESSSCRIFR AEIWKGAAAA AHDHHDQEAA TAAALHHDQP RRRLDHIVAG  240
RPPPPPASSS GGGGGGDTMA SSLDWLLASR RQKQHDYGDH YDGDGGYYTA AHRGQAAAAM  300
SAAAAASGVV KDRRPSLEMS LGRQGWEITM EQRSSVESSS KELTLLKCL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1097270.0AK109727.1 Oryza sativa Japonica Group cDNA clone:002-146-B09, full insert sequence.
GenBankAL9548290.0AL954829.6 Oryza sativa chromosome 12, . BAC OSJNBa0044E20 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618990.11e-144uncharacterized protein LOC4352677
TrEMBLA0A0E0FDM60.0A0A0E0FDM6_9ORYZ; Uncharacterized protein
STRINGOMERI12G12110.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.27e-29G2-like family protein