PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G11530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 737aa    MW: 81268.9 Da    PI: 4.9539
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G11530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.64.7e-1103577291374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts    ++ l+a++l+  +  + k+s
  OMERI12G11530.1 357 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLMAKRTS---AVDILQAYQLYMAAICFKKVS 447
                      6789***************************************************999999999998888...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++R+Tg++ p++g   +e++eetg+rL+k+A+e+gvpf++n+++a ++
  OMERI12G11530.1 448 FIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRMTGIDLPQPGfrPTERIEETGRRLSKYAQEFGVPFKYNAIAAVKM 541
                      **********************************************************9*****************************9999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+ prese
  OMERI12G11530.1 542 ESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDATTPRESE 635
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +r  +E+ ++gr++ nv+aceg +r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++S W+
  OMERI12G11530.1 636 QRLLIEQNIFGRAALNVIACEGIDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQVVRNKVKDCYHKDFVIDIDHQWLLQGWKGRILYAISTWT 729
                      *****************************************************************889*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.877331709IPR005202Transcription factor GRAS
PfamPF035141.6E-107357729IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MGSSAADSFP AGGDDAIRDV YGIGGGGEED DPSLFLYLSD LAPVSPSAYL DLPPSPPPPP  60
ATTATTTVKE GEEAPEDLVL PFISRMLMEE DIDDKFFYDY PDNPALLQAQ QPFLEILSDP  120
SSNSRSSNSD DPRLSPTSSS DTSAAINSYD ASATAVASAA VPVPQYESIE LDPAAFFAAA  180
NSDLMSSAFL KGMEEANKFL PTENKLVIDL EASSENNYLR GLEEAKRFLP SDDKLQVGFA  240
AAASPVVSVK KEAVDVVVAT ASGGGGRGRK NPYDDEELEL EGGRSSKQTA VQGDDVAARA  300
MFDKVMMPSH ENCTEMMEKL RIAMKEEAAK NEASAGGKGG NGKVKGGRRG GRDVVDLRTL  360
LIHCAQAVAT DDRRSATELL KQIKQHAKPT GDATQRLAHC FAEGLQARIA GTGSLVHQSL  420
MAKRTSAVDI LQAYQLYMAA ICFKKVSFIF SNQTIYNASL GKKKIHIVDY GIQYGFQWPC  480
FLRRISQREG GPPEVRMTGI DLPQPGFRPT ERIEETGRRL SKYAQEFGVP FKYNAIAAVK  540
MESVRKEDLN IDPDEVLIVN CQYQFKNLMD ESVVIDSPRD IVLSNIRKMQ PHVFIHAIVN  600
GSFSAPFFVT RFREALFFYS ALFDVLDATT PRESEQRLLI EQNIFGRAAL NVIACEGIDR  660
VERPETYKQW QVRNQRAGFK QLPLNPEIVQ VVRNKVKDCY HKDFVIDIDH QWLLQGWKGR  720
ILYAISTWTP NDALSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-443617288374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0E0FDC60.0A0A0E0FDC6_9ORYZ; Uncharacterized protein
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-162GRAS family protein