PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G04030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 201aa    MW: 23124.8 Da    PI: 9.8494
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G04030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.27e-261058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr g+lKKA ELSvLCda+v viifss+gkl+e +
  OMERI12G04030.1 10 RIENPVHRQVTFCKRRGGLLKKARELSVLCDADVGVIIFSSQGKLHELA 58
                     8*********************************************965 PP

2K-box52.42.3e-188817216100
            K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                        +q +  L++ei+ Lqr +R   G + ++++l  L+ Le+ Le  + +iR++K++++ ++i+ l++ke  l+e+n++L++k++e
  OMERI12G04030.1  88 VAEQGIFLLREEIDLLQRGLRSTYGGGAGEMTLDKLHALEKGLELWIYQIRTTKMQMMQQEIQFLRNKEGILKEANEMLQEKVKE 172
                      55677778**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.4E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.464161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-28174IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.23E-38373No hitNo description
PRINTSPR004047.0E-27323IPR002100Transcription factor, MADS-box
PfamPF003196.3E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.45986176IPR002487Transcription factor, K-box
PfamPF014861.3E-1887170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRQVT FCKRRGGLLK KARELSVLCD ADVGVIIFSS QGKLHELATN  60
GNMHNLVERY QSNVAGGQME PGALQRQVAE QGIFLLREEI DLLQRGLRST YGGGAGEMTL  120
DKLHALEKGL ELWIYQIRTT KMQMMQQEIQ FLRNKEGILK EANEMLQEKV KEQQKLYTHL  180
LDLHSQQPTQ PMTYGNRFFS I
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1777000.0AY177700.1 Oryza sativa (japonica cultivar-group) transcription factor MADS33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878024.11e-145MADS-box transcription factor 33 isoform X4
SwissprotQ2QW551e-144MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0E0FAI81e-146A0A0E0FAI8_9ORYZ; Uncharacterized protein
STRINGOMERI12G04080.11e-146(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.14e-60AGAMOUS-like 12