PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G03740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 372aa    MW: 40853.3 Da    PI: 9.8224
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G03740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-072402731750
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      A+rsR RK+++i+eLe++v++L++e  +   e++
  OMERI12G03740.1 240 AQRSRVRKLQYIAELERRVQALQTEGVEVSAEMD 273
                      89*********************99776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-6229288IPR004827Basic-leucine zipper domain
CDDcd147031.02E-15230280No hitNo description
SuperFamilySSF579595.4E-6239282No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-6240294No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MMANARFQKQ ALLPPRSPFP AAVGAAPSPS PHAELGPIAR PRDAPHRHGH QRTSSESVLI  60
DEQPSWLDDL LDEPEAAARP HGRPGHRRSS SDSFTLFDGG ASAAAAGMYD NVFDGMRGRG  120
GGGQQVGSWG GVPEFFPEQS SFGRPQGQGG RPWDSRLMLR QGGGGGGGMP VPMREMNGGH  180
HGPPNAFGDH GHGSLPNGVD RKGPGDSAHD QRMGAERKEG AHLRHSQSEA DTKRAKQQYA  240
QRSRVRKLQY IAELERRVQA LQTEGVEVSA EMDFLGQQNI MLDLENKALK QRLESLSQEH  300
LIKRFQQEMF EREIGRLRSL FQQQQQQQHI PQQQGPTHSR SNSRDLDSQF ANMSLKHGDP  360
NSGRDAVPGL RI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2875550.0AK287555.1 Oryza sativa Japonica Group cDNA, clone: J065019F14, full insert sequence.
GenBankAK2877160.0AK287716.1 Oryza sativa Japonica Group cDNA, clone: J065134G21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618309.10.0uncharacterized protein At4g06598
RefseqXP_025877630.10.0uncharacterized protein At4g06598
TrEMBLA0A0E0FAF20.0A0A0E0FAF2_9ORYZ; Uncharacterized protein
STRINGOMERI12G03770.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.22e-61bZIP family protein