PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G02900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 558aa    MW: 59219 Da    PI: 4.5808
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G02900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM77.43.3e-24311671127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev..ikevdiykvePwdLpk.....kvkaeekewyfFskrdkkya....tgkrknr.atksgy 82 
                      lppG+ F+Pt ee +++yL++ ++gk++++ e+  ++ +d+y   P  L++        +   +w+f ++r+++++     +kr++r +++ g+
  OMERI12G02900.1  31 LPPGVYFNPTREEAMHHYLNRWIAGKTIPEMEAgfVAGADVYGDGPDALRRrhrpgYWCNYVYKWFFLCHRKRQSSrrttGNKRAERvVATGGR 124
                      79*************************777664459999**********85345542222455999*99999988744422458888667799* PP

              NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      Wk     k+vl  +g   g +++L fy+ ++ k +kt+W+m+ey+
  OMERI12G02900.1 125 WKVEQG-KKVLG-GGGGGGERDSLGFYSSNSTKESKTSWIMEEYT 167
                      **6544.68888.88899**************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-2428188IPR003441NAC domain
PROSITE profilePS5100529.98531188IPR003441NAC domain
PfamPF023651.0E-1532167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MDVDPPPPLP LPPPPPPPPP ATPQPNTAVE LPPGVYFNPT REEAMHHYLN RWIAGKTIPE  60
MEAGFVAGAD VYGDGPDALR RRHRPGYWCN YVYKWFFLCH RKRQSSRRTT GNKRAERVVA  120
TGGRWKVEQG KKVLGGGGGG GERDSLGFYS SNSTKESKTS WIMEEYTSST ADGEEGRMVP  180
VLCKIYLSPR APAGEKRALF GEDGVAVGPD GRKRNARATV LATLFDDVAA LLGQPVAAAP  240
PLPAPGDQLG HGHFDDVAAR FGQVAVAGDL GHGYFDDAAA LLGQVAMAPA PGHHQQGYVV  300
AEALPESGYL GRYHHDGHFA QAAAPEQDCY LGYHSHDAHV AEATPEQGYH DDAHVAVAPA  360
PEQGDLGHDQ GHLAAALTPE ECGEIVGTYE FHPEMVQMLS MGFAVPDEQL LPRLLDPIGG  420
GYDMASSAAA AVGDVNAYIA AAAPTPRIRS NAAEAMAATA MAETMPPPLD AVAAELSAPP  480
RGLPPELAFS ALPSVQQEPS CDDDDDSNFG ELVAEAMPPL IGENAGVDAG SDEPLPDLAG  540
IMPELDFGHD FFSNQHRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0FA360.0A0A0E0FA36_9ORYZ; Uncharacterized protein
STRINGORGLA12G0043800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135701724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55210.11e-14NAC domain containing protein 63