PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G01070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 794aa    MW: 87764.6 Da    PI: 5.8219
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G01070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-10662707550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      k+ r+   NReA r++Rq+Kka +++Lee+vk L a N++L k+l+
  OMERI12G01070.1 662 KKGRKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRAINQQLVKRLQ 707
                      78899999**********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF549281.55E-35108273IPR012677Nucleotide-binding alpha-beta plait domain
Gene3DG3DSA:3.30.70.3301.9E-22110187IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010217.012111187IPR000504RNA recognition motif domain
SMARTSM003601.1E-21112183IPR000504RNA recognition motif domain
PfamPF000762.6E-16113180IPR000504RNA recognition motif domain
CDDcd005903.78E-20113183No hitNo description
Gene3DG3DSA:3.30.70.3302.3E-15188268IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010211.486189270IPR000504RNA recognition motif domain
SMARTSM003607.4E-12190266IPR000504RNA recognition motif domain
PfamPF000761.5E-10191255IPR000504RNA recognition motif domain
CDDcd005901.05E-11191257No hitNo description
Gene3DG3DSA:3.30.70.3306.4E-22269362IPR012677Nucleotide-binding alpha-beta plait domain
SuperFamilySSF549281.25E-21276362IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010215.528282359IPR000504RNA recognition motif domain
SMARTSM003605.4E-18283355IPR000504RNA recognition motif domain
PfamPF000766.1E-16284352IPR000504RNA recognition motif domain
Gene3DG3DSA:1.20.5.1703.4E-12657725No hitNo description
SMARTSM003381.6E-8658725IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.841660707IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.45E-7662707No hitNo description
PfamPF077167.9E-11662711IPR004827Basic-leucine zipper domain
CDDcd146862.93E-10665707No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MPRRTDNAAS ANSVEPEKSE ECLEFDDDEE EVEEEEIEYE EIEEEIEEEE EVEEDEDVVE  60
EVEEVDEEED EEEEEESDEN EGVSKTKGVH QKDVTEKGKH AELLALPPHG SEVYVGGISS  120
DVSSEDLKRL CEPVGEVVEV RMMRGKDDSR GYAFVNFRTK GLALKAVKEL NNAKLKGKWI  180
RVSSSQAKNK LFIGNVPHSW TDDDFRKAVE EVGPGVLKAD LMKVSSANRN RGYGFVEYYN  240
HACAEYARQE MSSPTFKLDS NAPTVSWADP KNNDSASTSQ VKSVYVKNLP KNVTQAQLKR  300
LFEHHGEIEK VVLPPSRGGH DNRYGFVHFK DRSMAMRALQ NTERYELDGQ VLDCSLAKPP  360
AADKKDDRVP LPSSNGAPLL PSYPPLGYGI MSVPGAYGAV PASTTQPMLY APRAPPGAAM  420
VPMMLPDDNS LVDSCRWLRR RRSKLDIVAA VEDVMAAVAA AMAAVVAAPA VAGQVQSGRE  480
EMTTAAAATK AGAALPSIHL CKHMEYEISG PESEVDSEVW LGWVARRRPC NPKASTASLV  540
RCFSTSRLLR GTSYRAAPGH SSIFRSTARP QSIERRRHCD PAVLASGERE IVLSSQMMFP  600
NPEIPTSLDD FLPSIRTTCT HTHTCNPPGP SAAPHTHTCY HTHTRVFSSD DDSCGGDKAK  660
PKKGRKPLGN REAVRKYRQK KKAHTAHLEE EVKRLRAINQ QLVKRLQGQA AFEAEVARLR  720
TSLVDVRSRI NGALGSYPLQ AQCGVDNVLG CDGMAQCFAG KPELGHKSAS QLEMPDEQHK  780
PVLKLFKYNK NKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6r5k_D2e-149136922305Polyadenylate-binding protein, cytoplasmic and nuclear
6r5k_F2e-149136922305Polyadenylate-binding protein, cytoplasmic and nuclear
6r5k_H2e-149136922305Polyadenylate-binding protein, cytoplasmic and nuclear
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687000.0AK068700.1 Oryza sativa Japonica Group cDNA clone:J013160I09, full insert sequence.
GenBankAK0694930.0AK069493.1 Oryza sativa Japonica Group cDNA clone:J023024M07, full insert sequence.
GenBankAY2245810.0AY224581.1 Oryza sativa (japonica cultivar-group) isolate 30848 putative RNA-binding protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619732.10.0heterogeneous nuclear ribonucleoprotein Q isoform X2
RefseqXP_015619733.10.0heterogeneous nuclear ribonucleoprotein Q isoform X2
RefseqXP_015619734.10.0heterogeneous nuclear ribonucleoprotein Q isoform X2
RefseqXP_025877774.10.0heterogeneous nuclear ribonucleoprotein Q isoform X2
TrEMBLA0A0E0F9B30.0A0A0E0F9B3_9ORYZ; Uncharacterized protein
STRINGOMERI12G01040.20.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94289
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.12e-39bZIP family protein