PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G19270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 136aa    MW: 15616.5 Da    PI: 9.1244
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G19270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.71.7e-1767555127
              NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                       + w++F ++++     +r  r+t sgyWk+ g+   v+s++++ vglkk++ fy+g +p+g+kt+W ++e+ 
  OMERI11G19270.1   6 GEPWFYFRHHERWM---HRMDRSTPSGYWKTAGTASFVYSADRHPVGLKKSMLFYRGPEPSGRKTKWKIDEFW 75 
                      45799999888865...69****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100521.3971114IPR003441NAC domain
SuperFamilySSF1019418.76E-18686IPR003441NAC domain
PfamPF023652.0E-7774IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MGAGAGEPWF YFRHHERWMH RMDRSTPSGY WKTAGTASFV YSADRHPVGL KKSMLFYRGP  60
EPSGRKTKWK IDEFWALHNA ANGSEELLAQ LCRSRQNVGL MPRFPVSLCR LYSTKSSSER  120
HVLTTSSDEI SEDESD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1356441e-152AC135644.2 Oryza sativa (japonica cultivar-group) chromosome 11 BAC clone OSJNBa0085H07, complete sequence.
GenBankAP0149671e-152AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615335.11e-87PREDICTED: putative disease resistance RPP13-like protein 2 isoform X1
RefseqXP_015615336.11e-87PREDICTED: putative disease resistance RPP13-like protein 2 isoform X1
TrEMBLA0A0E0F8S12e-99A0A0E0F8S1_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g45950.11e-94(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2689955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-20NAC domain containing protein 90