PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G18020.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 569aa    MW: 63072.4 Da    PI: 7.7162
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G18020.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.93.1e-19180223245
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                      + en+  r+vt+skRr gilKKA+ELS+LCd+   +++fs+++k
  OMERI11G18020.2 180 KLENSGGRHVTYSKRRSGILKKAKELSILCDIPLILLMFSPNDK 223
                      679999**********************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.876171223IPR002100Transcription factor, MADS-box
SMARTSM004328.9E-26171230IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.22E-23172265IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-14173193IPR002100Transcription factor, MADS-box
PfamPF003192.5E-16182224IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-14193208IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-14208229IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MCLNLSRSLP RVSLLFSLSF LDLLSLSSSS SSFSFSLSRP IHPRTADFAG SIPTPTPLPR  60
GRSIDRSFDR SEQANSLIPL SLSSVLGSTQ LPDDFILNHR RRRRHRQEEE KKLHLGLSIG  120
CSDFFWIYSC SLCAPGIRSL GRAVISASRV STNWTADSSP SLRRGDSASA MGRVKLKIKK  180
LENSGGRHVT YSKRRSGILK KAKELSILCD IPLILLMFSP NDKPTICVGD HSSIEDVITK  240
YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEVHISI QKDDIAAYAF  300
LVSCFLCLCV QMLIKSIVWQ ELSSHLGALQ CQMADVEKRL SYWSDPEKVE NIDHIRAMEQ  360
SLKESLNRIR IHKENFAKQH LMSLQCAAAQ FQNDMQLPLG LTGDPNTSSW FHGGGGAEAQ  420
QPMMLPEDPS LLHQRDIGCS ASTSLQSYPG YFSMGKQSTD NAGGGEQHHH AAVQQQQQQP  480
EFSQADCLTS LQLGAQFPYP SAFDNAGLLS DRLFDNAAAA MDFGSHYDLP RPGDEASFQN  540
WASAACGATM YDHHQQQQQQ QQPAQPSMT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565050.0FM956505.1 Oryza sativa Japonica Group mRNA for MADS68 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618004.10.0agamous-like MADS-box protein AGL65 isoform X3
TrEMBLA0A0E0F8A80.0A0A0E0F8A8_9ORYZ; Uncharacterized protein
STRINGOMERI11G17850.20.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.14e-74AGAMOUS-like 65