PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G12070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 282aa    MW: 30998.2 Da    PI: 7.976
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G12070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM106.53.4e-33181481128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lp+G+ F+Pt+ elvv+yL +++ +++l++ ++i++vdi  ++Pwd+   + ++++  +fF+++++++++++++n a+ +g+W+  g++ ++++
  OMERI11G12070.1  18 LPVGCVFRPTEGELVVNYLYRRAMQEPLPC-DFITDVDIQCHNPWDIV-PAGEKKNGKHFFTRKENSHPRDHESNHAAGDGFWRLVGTEVPIYN 109
                      799***************************.99**************5.455667899************************************ PP

              NAM  95 k.....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      k     +++lvg+k+tLvf+  +++++e+t Wvm+e+rl
  OMERI11G12070.1 110 KpsggaDEKLVGMKRTLVFHFRKSSSAERTGWVMQEFRL 148
                      *999988889**********99***************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-3515158IPR003441NAC domain
PROSITE profilePS5100533.96418214IPR003441NAC domain
PfamPF023651.1E-1719148IPR003441NAC domain
SuperFamilySSF1019411.31E-35202214IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAGPGVCINL LNGTTMHLPV GCVFRPTEGE LVVNYLYRRA MQEPLPCDFI TDVDIQCHNP  60
WDIVPAGEKK NGKHFFTRKE NSHPRDHESN HAAGDGFWRL VGTEVPIYNK PSGGADEKLV  120
GMKRTLVFHF RKSSSAERTG WVMQEFRLAG ASLVPCLVMR LATGDVSMSP CGCTETSTTK  180
KNNGSPSAAH THAPLVETML EPDNSWMICR IYKKRQRAPQ VKIPPSIGNA REAVLTVPAI  240
GNAGDRQVNF IDFPGHRCFE EGSDESANVT TKDKGSDGYG KN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-201614813140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126191e-166CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616648.11e-125PREDICTED: NAC transcription factor NAM-1
TrEMBLA0A0E0F6170.0A0A0E0F617_9ORYZ; Uncharacterized protein
STRINGBGIOSGA035329-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.14e-27NAC domain containing protein 47